Conserved Protein Domain Family
BchF

?
TIGR02020: BchF 
2-vinyl bacteriochlorophyllide hydratase
This model represents the enzyme responsible for the first step in the modification of the ring A vinyl group of chlorophyllide a which (in part) distinguishes chlorophyll from bacteriochlorophyll. This enzyme is aparrently absent from cyanobacteria (which do not use bacteriochlorophyll). [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 131075
View PSSM: TIGR02020
Aligned: 4 rows
Threshold Bit Score: 196.956
Threshold Setting Gi: 499235548
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL76372      36 FYTPEQRLRRDSSVWTTVQGVLAPLQFLAFALSLVFVINFLA--NGTGYSAAVISVLIKTLFLFTIMVTGAIWEKVVFGR 113 uncultured mari...
BAA76535      39 LYSIEERRRRDATKWTLVQGILAPIQFVVFLVSLSLVAHYLI--TGNGLALATDSILVKTIVLFTIMITGAIWEHEVFGK 116 Acidiphilium ru...
WP_010933436  36 RYTPEQLAKRNASVWTDIQIILAPIQFFIFLGGITLNTLYYFnlAGIDFYWISIAILFKTLFFAILFITGMFFEKEIFNH 115 Chlorobaculum t...
WP_010933088   3 RYTPEQLEKRNASKWTTVQAILAPIQFLIFLAGLTVTYLYSQgiWVTDFWWVTFFVALKTFMLVLIFVTGGFFELEVFGK 82  Chlorobaculum t...
AAL76372     114 YLFAPAFFWEDVVSMLVIFLHVAYVVSWLFDLQAPREQMWLAIAAYTAYVINAAQFLLKLRAARV 178 uncultured marine proteobacterium
BAA76535     117 YLFARAFFWEDLFSMLVIALHSLYVLVLFTHIAGPQTQMMIALAAYATYLINAMQFIMKLRAARL 181 Acidiphilium rubrum
WP_010933436 116 WIYSKEFLWEDVGSTVAAFFHLLYFVMA-WMEYPEHVLVVEAYIAYLTYVLNALQYLVRIILEKN 179 Chlorobaculum tepidum
WP_010933088  83 FAFAHEFFWEDFGSAIAMIVHISYFILFFWIKPAEHILILTAYLAYLSYLVNAAQFVIRLLLEKH 147 Chlorobaculum tepidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap