Conserved Protein Domain Family
BchJ

?
TIGR02019: BchJ 
bacteriochlorophyll 4-vinyl reductase
This model represents the component of bacteriochlorophyll synthetase responsible for reduction of the B-ring pendant ethylene (4-vinyl) group. It appears that this step must precede the reduction of ring D, at least by the "dark" protochlorophyllide reductase enzymes BchN, BchB and BchL. This family appears to be present in photosynthetic bacteria except for the cyanobacterial clade. Cyanobacteria must use a non-orthologous gene to carry out this required step for the biosynthesis of both bacteriochlorophyll and chlorophyll. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131074
View PSSM: TIGR02019
Aligned: 3 rows
Threshold Bit Score: 272.141
Threshold Setting Gi: 14194483
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAG15203       9 RIGPNSIIQTVAAARAQYGEEAVADWLRRTGrgHLLEAMPDHMLPESEFGDLIADLRFWLGVsAAADVLAQSGDLTAQYV 88  Chloroflexus au...
Q9Z5D7        17 RIGPNAILQLIPVLEAAFGPGAADRALAAAG--VPRPGPESGMLPETQVSTLHRWLRDTHPE-EAPRLLREAGLATGDYI 93  Rhodobacter sph...
WP_010933670   7 RIGPNSIIQTVGALETAYGKNETEKLLKKIGqgYLINNLPSEMVEESKFHALVTALQKELGEtATAGILKESGERTAKYL 86  Chlorobaculum t...
AAG15203      89 ATHRVPVPIRWLLPRLPVGLALRIFLPAIARHAWTFAGSGRFGYTLQPAWRLTLADSVEARGVRATEPVCA-YYRAAFEG 167 Chloroflexus au...
Q9Z5D7        94 LANRIPPLAQRLIRALPAFLGARVLATAIAKHSWTFAGSGKFRVVSGRPLSFEIARNPVVAGESSDTPLCH-WHAAVFER 172 Rhodobacter sph...
WP_010933670  87 LKVRIPGPFQTIVKLLPAGLAFKVLLFAISKNAWTFAGSGEFSYGSKPSPNVMVKVTFP------SHPVVSnFYLGTFTA 160 Chlorobaculum t...
AAG15203     168 LLRRVVCDRLRVHEVACRAMGTGRCEFAV 196 Chloroflexus aurantiacus
Q9Z5D7       173 LFSRLVWPHVAVRETACCAKGAPACRFEL 201 Rhodobacter sphaeroides 2.4.1
WP_010933670 161 LLRELVSPKTEIKADIRKEGSAIRCNYLC 189 Chlorobaculum tepidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap