Conserved Protein Domain Family
hutG_amidohyd

?
TIGR02017: hutG_amidohyd 
N-formylglutamate amidohydrolase
In some species, histidine is converted to via urocanate and then formimino-L-glutamate to glutamate in four steps, where the fourth step is conversion of N-formimino-L-glutamate to L-glutamate and formamide. In others, that pathway from formimino-L-glutamate may differ, with the next enzyme being formiminoglutamate hydrolase (HutF) yielding N-formyl-L-glutamate. This model represents the enzyme N-formylglutamate deformylase, also called N-formylglutamate amidohydrolase, which then produces glutamate. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131072
View PSSM: TIGR02017
Aligned: 6 rows
Threshold Bit Score: 451.532
Threshold Setting Gi: 499258046
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010918842   3 DWLQVVRGSAPLIISLPHTGTDIPPDIESQLASPWLARKDADWWVEQLYAFAENLGATLVRTAISRTVIDVNRDPSGASL 82  Caulobacter vib...
WP_011036760   6 DWLHVQRGNAPLLISFPHTGTDLPQSVANHFVSPWLACRDTDWWVDQLYDFAQSLGATTVRTTVSRSVIDVNRDPSGASL 85  Xanthomonas cam...
WP_006192209   2 RAVETRQGNSPVILGLPHTGTDVPDDIWSRLNDNGKILADTDWHIHKLYDGLID-GATFVRATFHRYCIDANRDPAGVSL 80  Brucella
WP_002211282   5 DSYYFQGGKIPLLISIPHAGTRLTPAVEAGLTAAAQPLSDTDWHIHRLYDFAREMGASVLIGQYSRLVVDLNRPQDDQPL 84  Yersinia pestis
WP_010915528   6 PWLTVSRGTAPLLVSIPHTGIDLAG-LEPRLVSPWLGRRDCDWWIDKLYDFANDLGATVVHTAISRTVIDVNRDPTGVSL 84  Mesorhizobium loti
WP_010955586   3 KVLSFHQGRLPLLISMPHAGLRLTDAVRDGLVDQAQSLPDTDWHIPQLYDFARDMGASVVAAEYSRFVIDLNRPEDDKPL 82  Pseudomonas putida
WP_010918842  83 YPGQATTELCPTTTFDGEPLYRDG-GPDAAEIDHRRTTYFEPYHAALRSEIERLRAVHPTVVLYEAHSIRSRVPRLFEGE 161 Caulobacter vib...
WP_011036760  86 YPGQHTTGLCPLTTFDNQPLYRDGqAPDPAQIALRRTQWFDPYHAALADEIARLRALHPRIVVYDAHSIRSHIPHLFAGE 165 Xanthomonas cam...
WP_006192209  81 YPGQNTTTLIPETDFDGLSIWKDGeAPTEADIVDRIARFHRPYHDALAAEIERVKAIHGVAILYDCHSIRSHIPFLFEGK 160 Brucella
WP_002211282  85 YAT-ATTGLFPETLFDGRACFEAGkTPSPNERQSYLTHIWQPYHQRLQQELARLSAQFGYALLLDAHSIASVIPRLFDGQ 163 Yersinia pestis
WP_010915528  85 YPGQTTTTLCPTDTFDGDPLYRMGeEPTPSEIDQRRETYFKPYHAALQAEIDRLRGMHEKIVLYDCHSIRSVLPRLFEGT 164 Mesorhizobium loti
WP_010955586  83 YVG-ATTGLYPATLFGGEPLFKDGlAPSGEERKRYLEQIWRPYHTTIRRELDRLREQFGYALLWDAHSIRSLIPHLFDGK 161 Pseudomonas putida
WP_010918842 162 LPQFNLGTNSGQSCADALTVAVEAACd-ASGLSRVTNGRFKGGWTTRHYGQPATGVHAIQMELACRGYMDD-------PA 233 Caulobacter vib...
WP_011036760 166 LPQFNIGSNDDASCDPALADAVEQLCr-SSGSSTVRNGRFKGGWITRHYAQPDQGVHALQMELACRGYMQEpeq-itpDT 243 Xanthomonas cam...
WP_006192209 161 LPDFNIGTDMGKTCDPGIEAAAVEVTakAKGYTSILNGRFKGGWTTRHYGRPQTGVHAIQMELAQSTHLAA-------EA 233 Brucella
WP_002211282 164 LPDLNIGTNDNASCLLSLTEQLIACCqrQTAFSHVLNGRFKGGYITRTYGLPQNHHHAVQLELAQLNYMS--------ET 235 Yersinia pestis
WP_010915528 165 LPVFNLGTNDGKSTDPVLQDKVAAILa-ATGETWVVNGRFKGGSITRGFGQPQNGVHALQMELSNRGYMREpsekgspEN 243 Mesorhizobium loti
WP_010955586 162 LPDFNLGTFNGASCDPALADRLQGVCakVQGYNHVLNGRFKGGHITRHYGDPANHIHAVQLELAQSTYM-E-------EV 233 Pseudomonas putida
WP_010918842 234 EpptpdtwPTPFHAARAEPLRAVLEEVLGACLDFANT 270 Caulobacter vibrioides
WP_011036760 244 W-------PTPWQPVHAAALRAVLRHVLRACLDFAAG 273 Xanthomonas campestris
WP_006192209 234 V-------PFAYDEAKADTLRVHLKTLLQRLETIAAE 263 Brucella
WP_002211282 236 E-------PYAYRPDRAIHLQQLLQQFITTMLTWGEQ 265 Yersinia pestis
WP_010915528 244 W-------PVPYDPTYAAPIRATLKTILETAIDWARR 273 Mesorhizobium loti
WP_010955586 234 E-------PFAYREDLAQPTQAVLRQLLQALLAWGDE 263 Pseudomonas putida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap