Conserved Protein Domain Family
BchY

?
TIGR02015: BchY 
chlorophyllide reductase subunit Y
This model represents the Y subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase. This enzyme is responsible for the reduction of the chlorin B-ring and is closely related to the protochlorophyllide reductase complex which reduces the D-ring. Both of these complexes in turn are homologous to nitrogenase. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 131070
View PSSM: TIGR02015
Aligned: 3 rows
Threshold Bit Score: 677.805
Threshold Setting Gi: 499235946
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL76353      57 DYPVGPHDQPQSMCPAFGSLRVGLRMQRTATVLSGSACCVYGLTFTSHFYGARRTVGYVPFDSESLVTGKLFEDIRESVH 136 uncultured mari...
P26178        37 DYPVGPHDKPQTMCPAFGALRVGLRMRRVATVLCGSACCVYGLSFISHFYGARRSVGYVPFDSETLVTGKLFEDVRASVH 116 Rhodobacter cap...
WP_010933486   1 ------------MCPAFGGLRVLMRIDGAQVCMAADQGCLYGLTFVSHFYAARRSIVSPELMNAQISGGTMIDDVRCTIE 68  Chlorobaculum t...
AAL76353     137 TLADPAKYDAVVVINLCVPTASGVPLDLLPKSINGVRIIGIDVPGFGVPTHAEAKDVLAAAMLKYARSEVSAGPVARPTS 216 uncultured mari...
P26178       117 DLADPARYDAIVVINLCVPTASGVPLQLLPNEINGVRVVGIDVPGFGVPTHAEAKDVLSGAMLAYARQEVMAGPVPAPIS 196 Rhodobacter cap...
WP_010933486  69 KIAEDPSVRFIPVVSTCVAETAGIAEELLPKRVGNADVLLVRLPAFQIRTHPEAKDVAVSSLVK---R---FGAFGEPKK 142 Chlorobaculum t...
AAL76353     217 LesRDSKPSIALLGEIFPVDAIVIDRLLRPLGASAGPVVPTREWRELYAALDSSLVAMLHPFYSACNREFVAAGKPVIGS 296 uncultured mari...
P26178       197 G--RSDRPTVTLLGEMFPADPMVIGAMLAPMGLAVGPTVPMRDWRELYAALDSKVVAAIHPFYTAAIRQFEAAGRAIVGS 274 Rhodobacter cap...
WP_010933486 143 G------KTLVVLGEIFPVDAMMIGGVLQKIGVESVITLPGADLDDYVQAGRASACAVLHPFYERTAALFESAGVKIVGG 216 Chlorobaculum t...
AAL76353     297 APVGAEGTAEWLTAIGTALGTPADVMTKHRDTLRKSIAEAIA--ANPIKARMTLSGYEGSELLVGRLLVESGADLRYVGS 374 uncultured mari...
P26178       275 APVGHDGTMEWLANIGRAYDVSPDKIAAAQNAFGPAIRGAIA--GAPIKGRITVSGYEGSELLVARLLIESGAEVPYVGT 352 Rhodobacter cap...
WP_010933486 217 NPIGANATGQWIERIGEALDLDPETVKTVAEEERQKAKGMMAgfAERMHGSVIVAGYEGNELPLVRLLLEAGLDVPYAST 296 Chlorobaculum t...
AAL76353     375 ACPGTKWNAHDKEWLEAHGVTVKFRASLEDDTCAVDAFEPDLAIGTTPVVQHAKQKGVPSLYFTNLISARPLMGPAGAGS 454 uncultured mari...
P26178       353 AAPRTPWSAWDKDWLESRGVVVKYRASLEDDCAAMEGFEPDLAIGTTPLVQKAKALGIPALYFTNLISARPLMGPAGAGS 432 Rhodobacter cap...
WP_010933486 297 SIARTALGEEDHRLLTMLGTEVRYRKYLEEDMEAVLEHKPDLVIGTTSLDSFAKEHGIPAIYYTNNISARPIFFASGAAS 376 Chlorobaculum t...
AAL76353     455 LSQVINTAVNNKSRFAAMDSFFEGVG 480 uncultured marine proteobacterium
P26178       433 LAQVMNAAMGNRERMGKMKAFFEGVG 458 Rhodobacter capsulatus SB 1003
WP_010933486 377 VLGMIAGLLEKREIYGRMKEYFMPSA 402 Chlorobaculum tepidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap