Conserved Protein Domain Family
BchZ

?
TIGR02014: BchZ 
chlorophyllide reductase subunit Z
This model represents the Z subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase. This enzyme is responsible for the reduction of the chlorin B-ring and is closely related to the protochlorophyllide reductase complex which reduces the D-ring. Both of these complexes in turn are homologous to nitrogenase. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 131069
View PSSM: TIGR02014
Aligned: 3 rows
Threshold Bit Score: 805.313
Threshold Setting Gi: 499236239
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB67241       2 MLLDHDRAGGYWGAVYVFGALKGLQVVIDGPVGCENLPVTAVLHYTDALPPHELPIVVTGLGESELGrDGTEAAMTRAHA 81  Rhodospirillum ...
AAF24299       2 LVQDHDRAGGYWGAVYAFCAVKGLQVVIDGPVGCENLPVTSVLHYTDALPPHELPIVVTGLGESEMS-EGTEASMSRAWK 80  Rhodobacter sph...
WP_010933779   4 TIRDESTASAYWAAVNTFCALKDVHVIADAPVGCYNLAGVAVMDYTDAIPYLEN-LTPTSLTEREISsSGSSQIVQETIE 82  Chlorobaculum t...
AAB67241      82 TLD-PSRPAVVVTGSIAEMIGGG----VTPAGTGLKRFLPRTIDEDQWQSADRALRWLWSEFGAG---KRTKtPARPAEA 153 Rhodospirillum ...
AAF24299      81 VLD-PALPAVVVTGSIAEMIGGG----VTPQGTNIQRFLPRTIDEDQWEAADRAMTWIFSEFGMTkgrMPPE-AKRPEGA 154 Rhodobacter sph...
WP_010933779  83 KLMgSGKQLILVSSAESEMIGSDhqhmLAMKYPSVRFFASDSLGENEWQGRDRALAWLFDQFDDG-----Q----PSQIE 153 Chlorobaculum t...
AAB67241     154 KPRVNIIGPSYGMFNMWSDIAEIRRLVEGIGAEIALEFPLGSHLDDVPRLAEADVNICLYREFGRGLCEALGKPYLQAPI 233 Rhodospirillum ...
AAF24299     155 KPRVNILGPMYGVFNMASDLHEIRRLVEGIGAEVNMVMPLGAHLAEMRHLVNADANIVMYREFGRGLAEVLGKPYLQAPI 234 Rhodobacter sph...
WP_010933779 154 PGTVSIIGPTYGCFNSPADLAEVKRLVTGAGGRVAHVYPFESKAAEITKLKNSAAIVVMYREFGAALAEKLGRPVLYAPF 233 Chlorobaculum t...
AAB67241     234 GLHSTTAFLRTLGQLLGLDPEP--FIEREKQTTIKPLWDLWRSVTQDFFGTASFGIAANETYSRGVRHFLEEEMGLPCRF 311 Rhodospirillum ...
AAF24299     235 GVESTTAFLRRLGEILGLDPEP--FIEREKHSTLKPVWDLWRSVTQDFFGTANFGIVATETYARGIRNYLEGDLGLPCAF 312 Rhodobacter sph...
WP_010933779 234 GIEETDRFIGKIGRLCGTPEQAtrFIAEEKRTTLSPVWDLWRGPQSEWFPTIRFGVVASKSYADGIKHVLGDELGMQCLF 313 Chlorobaculum t...
AAB67241     312 SFARKAGSKTDNQAIRQAIKDTPPLVLFGSFNERMYLAEANG----RGAYVPASFPGAIIRRHTGTPFMGYSGATYLVQE 387 Rhodospirillum ...
AAF24299     313 AVARKRGSKTDNEAVRGLIRQHRPLVLMGSINEKIYLAELKAghgpQPSFIAASFPGAAIRRATGTPVMGYAGATWLLQE 392 Rhodobacter sph...
WP_010933779 314 SLDS---AEVDNNAVRKEIVQKQPQFLYGRMPDKIYLAEADA----KSRFIPAGFPGPIVRRALGTPFMGHSGVVWLVQE 386 Chlorobaculum t...
AAB67241     388 VCNALFDMLFNILPMARDLDAVEATPSRMHDELPWDDEARAVLDRTVEAQPVVARISAAKRLRDAAERSARAAGEGQVTA 467 Rhodospirillum ...
AAF24299     393 VCNALFDALFHILPLGTEMDSAAATPTTLRRDFPWDADAQAALDRIVEEHPVLTRISAARALRDAAEKAALDAGAERVVR 472 Rhodobacter sph...
WP_010933779 387 IVNALYDTLFNFLPITRRQQAAAPTK-----PLKWTPEANAILDGIVRKAPFISQISFGRELKRKAENLAASRGADTVTP 461 Chlorobaculum t...
AAB67241     468 ARV 470 Rhodospirillum rubrum ATCC 11170
AAF24299     473 ETV 475 Rhodobacter sphaeroides
WP_010933779 462 DIL 464 Chlorobaculum tepidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap