1U94


Conserved Protein Domain Family
tigrfam_recA

?
TIGR02012: tigrfam_recA 
Click on image for an interactive view with Cn3D
protein RecA
This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 162659
View PSSM: TIGR02012
Aligned: 14 rows
Threshold Bit Score: 550.821
Threshold Setting Gi: 22096049
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U94_A         9 NKQKALAAALGQIEKQFGKGSIMRLG-EDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAA 87  Escherichia coli
Q9A9A7        16 DKQRALEAALAQIDRAFGKGSVMKLG-EKGKVEIESVSTGSLGLDIALGIGGLPKGRIVEVYGPESSGKTTLALHVVAEV 94  Caulobacter cre...
P42445         6 DKQKAISLAIKQIDKVFGKGALVRLG-DKQVEKIDSISTGSLGLDLALGIGGVPKGRIIEIYGPESSGKTTLSLHIIAEC 84  Helicobacter py...
O52393        17 ARLKQLNLAIETLEKQFGKGAIMRLGdDSAVMHVQVISTGSMALDYALGVGGLPRGRVTEIYGPESSGKTTLALHAIAEA 96  Chlorobium tepi...
O67905         7 EKKKALEVALSNIEKRFGKGAVMPLKsVEKVQ-VETIPTGSLALDIATGVGGIPKGRITEIFGVESSGKTTLALHVIAEA 85  Aquifex aeolicu...
P42443        17 ERSKAIETAMSQIEKAFGKGSIMKLG-AESKLDVQVVSTGSLSLDLALGVGGIPRGRITEIYGPESGGKTTLALAIVAQA 95  Deinococcus rad...
WP_014546999  15 EKAKAVEAAIAQIEKNYGKGSIMALG-QQPVEDIPVIPTGCIQLDMALGVGGFPRGRIIEIYGPESSGKTTLALHAIAEA 93  Fibrobacter suc...
P48287         5 DRKRALEAAIAYIEKQFGAGSIMSLGkHSSAHEISTIKTGALSLDLALGIGGVPKGRIVEIFGPESSGKTTLATHIVANA 84  Chlamydia trach...
WP_004584116  13 KKLQALRMATEKIEKTFGKGAIMNMG-ANTVEDVSVIPSGSIGLDLALGVGGYPRGRIIEIYGPESSGKTTLAIHAIAEA 91  Porphyromonas g...
WP_011057924  12 EKRKALEFAISQIERSFGKGSIMRLG-DATSMKVETISSGALTLDLALG-GGLPKGRIIEIYGPESSGKTTLALHAIAEV 89  Thermosynechoco...
1U94_A        88 QREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSH 167 Escherichia coli
Q9A9A7        95 QKAGGTAAFVDAEHALDPSYAYKLGVNLDNLLVSQPDNGEQALEITDTLVRSGAVDIVVVDSVAALTPKAEIEGEMGDSL 174 Caulobacter cre...
P42445        85 QKNGGVCAFIDAEHALDVHYAKRLGVDTENLLVSQPDTGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQH 164 Helicobacter py...
O52393        97 QKNGGIAALVDAEHAFDPTYARKLGVDINALLVSQPESGEQALSIVETLVRSGAVDIIVIDSVAALVPQAELEGEMGDSV 176 Chlorobium tepi...
O67905        86 QKRGGVAVFIDAEHALDPKYAKKLGVDVENLYISQPDYGEQALEIAESLINSGAVDVIVVDSVAALVPKDELEGEMGEAQ 165 Aquifex aeolicu...
P42443        96 QKAGGTCAFIDAEHALDPVYARALGVNTDELLVSQPDNGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEGDMGDSL 175 Deinococcus rad...
WP_014546999  94 QKLGGVAAFIDAEHAFDAVYARKLGVDIESLLVSQPDTGEQALDIAETLVRSGAIDIIVVDSVAALVPQAEINGEMGDNH 173 Fibrobacter suc...
P48287        85 QKMGGVAAYIDAEHALDPNYAALIGANINDLMISQPDCGEDALSIAELLARSGAVDVIVIDSVAALVPKSELEGEIGDVH 164 Chlamydia trach...
WP_004584116  92 QKAGGLAAIIDAEHAFDRTYAEKLGVNVDNLWIAQPDNGEQALEIAEQLIRSSAVDIIVIDSVAALTPKAEIEGEMGDNK 171 Porphyromonas g...
WP_011057924  90 QKAGGVAAFVDAEHALDPTYAAALRVDIQNLLVAQPDTGEAALEIVDQLVRSTAVDIIVVDSVAALVPRAEIEGDMGESH 169 Thermosynechoco...
1U94_A       168 MGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVM-FGNPETTTGGNALKFYASVRLDIRRIGA-VKEGE-NVVGS 244 Escherichia coli
Q9A9A7       175 PGLQARLMSQALRKLTASINKANTIVIFINQIRHKIGVM-YGSPETTTGGNALKFYASVRLDIRRTGS-VKARD-EIVGN 251 Caulobacter cre...
P42445       165 VGLQARLMSHALRKITGVLHKMNTTLIFINQIRMKIGMMgYGSPETTTGGNALKFYASVRIDIRRIAS-LKQNE-QHIGN 242 Helicobacter py...
O52393       177 VGLQARLMSQALRKLTGAISKSSSVCLFINQLRDKIGVM-YGSPETTTGGKALKFYSSVRLDIRKIAQ-IKDGE-ELVGN 253 Chlorobium tepi...
O67905       166 VGKQARLMSQALRKLKGAVHKSNTALIFINQIREKIGVM-FGNPETTPGGRALKFFSDMRLEVRRLGD-VKEGg-EKKGY 242 Aquifex aeolicu...
P42443       176 PGLQARLMSQALRKLTAILSKTGTAAIFINQVREKIGVM-YGNPETTTGGRALKFYASVRLDVRKIGQpTKVGN-DAVAN 253 Deinococcus rad...
WP_014546999 174 VGLQARLMSQALRKLTGILSKSNTCMLFINQLRMKIGVM-FGNPETTTGGNALKFYATQRIDIRRIAA-IKNGE-EVIGN 250 Fibrobacter suc...
P48287       165 VGLQARMMSQALRKLTATLARTNTCAIFINQIREKIGVS-FGNPETTTGGRALKFYSSIRIDIRRIGS-IKGGEnFDIGN 242 Chlamydia trach...
WP_004584116 172 VGLHARLMSQALRKMTGAISKSNTTCIFINQLREKIGVL-FGNPETTTGGNALKFYASIRIDIRKSTP-IKDGE-EIMGH 248 Porphyromonas g...
WP_011057924 170 VGLQARLMSQALRKINGNISKTGCTVIFLNQLRQKIGLT-YGNPETTTGGVALKFYASVRLDIRRVQT-LKKGT-EEFGI 246 Thermosynechoco...
1U94_A       245 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIE 324 Escherichia coli
Q9A9A7       252 NVRVKVVKNKVAPPFREVEFDIMYGEGISKLGEVIDLGVKAGIIDKAGSWFSYGSQRIGQGRDNVREFLKNNPDVAADIE 331 Caulobacter cre...
P42445       243 RAKAKVVKNKVAPPFREAEFDIMFGEGISKEGEIIDYGVKLDIVDKSGAWLSYQDKKLGQGRENAKALLKEDKALADEIT 322 Helicobacter py...
O52393       254 RTKVKVVKNKVAPPFKTAEFDILYGEGISVLGELIDLAVEFGIIKKSGAWFSYGTEKLGQGRENVKKLLKEDETLRNTIR 333 Chlorobium tepi...
O67905       243 RVKVRVVKNKLAPPFQEAEFDIIYGEGICKLCDLIEVATNLGIFTKSGSWYSYGDKRLGQGKEQVKKYLQEHPELIDEID 322 Aquifex aeolicu...
P42443       254 TVKIKTVKNKVAAPFKEVELALVYGKGFDQLSDLVGLAADMDIIKKAGSFYSYGDERIGQGKEKTIAYIAERPEMEQEIR 333 Deinococcus rad...
WP_014546999 251 RTRVKIVKNKVAAPFTQCEFDILYGVGISREASILDLACELDIIQKSGSWFSYNNERIGQGRENTRLFLKDNAELCSEIE 330 Fibrobacter suc...
P48287       243 RIKVKVAKNKLAPPFRTAEFDILFNEGISSAGCIIDLAVEKNIIDKKGSWFNYQDRKLGQGREAVREELKRNKELFHELE 322 Chlamydia trach...
WP_004584116 249 LTKVKVLKNKVAPPFRKAEFDIVFGEGISRSGEIIDLGVELDIIKKSGSWFSYGDTKLGQGREAAKEMIRDNEELAEELT 328 Porphyromonas g...
WP_011057924 247 RAKVKVAKNKVAPPFRIAEFDIIFGKGIANLGCILDMAEEVGVITRKGAWYSYNGENLAQGRDNTINYMEENPSFAQEIE 326 Thermosynechoco...
1U94_A       325 KKVRE 329 Escherichia coli
Q9A9A7       332 KAVRK 336 Caulobacter crescentus CB15
P42445       323 LKIKE 327 Helicobacter pylori 26695
O52393       334 QQVRD 338 Chlorobium tepidum TLS
O67905       323 QKVRE 327 Aquifex aeolicus VF5
P42443       334 DRVMA 338 Deinococcus radiodurans R1
WP_014546999 331 QKIRE 335 Fibrobacter succinogenes
P48287       323 RRIYE 327 Chlamydia trachomatis
WP_004584116 329 EKIRE 333 Porphyromonas gingivalis
WP_011057924 327 QQVRQ 331 Thermosynechococcus elongatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap