1I7H,3AH7


Conserved Protein Domain Family
fdx_isc

?
TIGR02007: fdx_isc 
Click on image for an interactive view with Cn3D
ferredoxin, 2Fe-2S type, ISC system
This family consists of proteobacterial ferredoxins associated with and essential to the ISC system of 2Fe-2S cluster assembly. This family is closely related to (but excludes) eukaryotic (mitochondrial) adrenodoxins, which are ferredoxins involved in electron transfer to P450 cytochromes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131062
View PSSM: TIGR02007
Aligned: 7 rows
Threshold Bit Score: 178.831
Threshold Setting Gi: 329665907
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1I7H_A         2 PKIVILPHQDLCPDGAVLEANS-GETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLE 80  Escherichia coli
P25528         2 PKIVILPHQDLCPDGAVLEANS-GETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLE 80  Escherichia coli
O51882         2 PKIFFLPHKLLLPKGGCFECKE-GETILNVALKNNIKLEHACEKSCACSTCHCIIRKGFLSLSGWSEKEEDVLDKAWGLE 80  Buchnera aphidi...
P44428         2 PKVIFLPNEDFCPEGMVVDAAT-GDNLLEVAHNAGVEIHHACDGSCACTTCHVIVREGFDSLNETSDQEEDMLDKAWGLE 80  Haemophilus inf...
WP_011000977   2 PQIVVLPHVEYCPEGAVIEAKP-GTSICDALLGAHIEIEHACEKSCACTTCHVIVREGFDSLGEATEKEEDLLDKAWGLE 80  Ralstonia solan...
WP_002217209   2 PKITVLPHTTLCPEGAVIDNAPeGKTVLDVLLDHDIEVDHACEKSCACTTCHVIIRKGFDSLEEPTELEEDLLDQAWGLE 81  Neisseria
3AH7_A         2 PLVTFLPHEKFCPEGLTVEVKP-GTNILELAHDHHIEMESACGGVKACTTCHCIVRKGFDSLEEADELEEDMLDKAWGLE 80  Pseudomonas putida
1I7H_A        81 PESRLSCQARVTDEDLVVEIPRYTINHAREH 111 Escherichia coli
P25528        81 PESRLSCQARVTDEDLVVEIPRYTINHAREH 111 Escherichia coli
O51882        81 STSRLSCQAIIGNIDIEVQIPLYNTNYIIEN 111 Buchnera aphidicola str. Sg (Schizaphis graminum)
P44428        81 MDSRLSCQCVVGNEDLVVEIPKYNLNHANEA 111 Haemophilus influenzae Rd KW20
WP_011000977  81 PNSRLSCQAKVADEDLTVEIPKYSINHAKET 111 Ralstonia solanacearum
WP_002217209  82 ADSRLSCQAVVAGEDLIVEIPKYTINHAREE 112 Neisseria
3AH7_A        81 AQSRLGCQVFVADEDLTIEIPKYSLNHAAEA 111 Pseudomonas putida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap