Conserved Protein Domain Family
IscS

?
TIGR02006: IscS 
cysteine desulfurase IscS
This model represents IscS, one of several cysteine desulfurases from a larger protein family designated (misleadingly, in this case) class V aminotransferases. IscS is one of at least 6 enzymes characteristic of the IscSUA-hscAB-fsx system of iron-sulfur cluster assembly. Scoring almost as well as proteobacterial sequences included in the model are mitochondrial cysteine desulfurases, apparently from an analogous system in eukaryotes. The sulfur, taken from cysteine, may be used in other systems as well, such as tRNA base modification and biosynthesis of other cofactors. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 131061
View PSSM: TIGR02006
Aligned: 6 rows
Threshold Bit Score: 751.644
Threshold Setting Gi: 8134586
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O51886         1 MKNPIYLDYAATTPVEFKVAKKMMNYLTIDgiFGNPASRSHKFGWEAEEVIDIARNEISELIGSDSREIVFTSGATEANN 80  Buchnera aphidi...
Q9JYY0         3 VKTPVYLDYAATPPVDKRVAEKMIPYLTET--FGNPASNSHSFGWEAEEAVEKARADIAALINADSKEIVFTSGATESNN 80  Neisseria menin...
Q9HXI8         1 MKLPIYLDYSATTPVDPRVAQKMSECLLMDgnFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDN 80  Pseudomonas aer...
P57803         1 MKLPIYLDYAATCPVDERVAKKMMEYLTVEgnFGNPASRSHKFGWQAEEAVDVARNYIADLIGADSREIVFTSGATESDN 80  Pasteurella mul...
Q9ZD60         8 LTLPIYMDYQSTTPIDPRVMEAMLPYFTTK--FGNPHSRSHSFGWEAENAVENARSMVAKVIGADSKEIIFTSGATESNN 85  Rickettsia prow...
WP_011714616   1 MSMPIYMDYQATTPMDPRVFEAMTPWFVEK--FGNPASRSHPYGWEADTAVENARQQVASSIGADPREIIFTSGATESDN 78  Magnetococcus m...
O51886        81 LAIKGIAFFHRKKGNHIITSKTEHKSVLDACRYLESVGFSVTYLTPKNNGIIDLNDLKKNINKNTILVSIMHVNNETGII 160 Buchnera aphidi...
Q9JYY0        81 LAIKGAAHFYKSKGNHLITVKTEHKAVLDTMRELERQGYEVTYLDVQENGLVDLDVLKAAIREDTILVSVMWVNNEIGVV 160 Neisseria menin...
Q9HXI8        81 LAIKGVAHFYSGKGKHIITSKIEHKAVLDTCRQLEREGFEVTYLEPGEDGLITPALVEAALRDDTILVSVMHVNNEIGTV 160 Pseudomonas aer...
P57803        81 LAIKGAAHFYQSKGKHIITCKTEHKAVLDTCRQLEREGFEVTYLNPKSDGLIDLEELKNAMRDDTILVSIMHVNNEIGVI 160 Pasteurella mul...
Q9ZD60        86 LVIKGIAKFYGNKKKHIITLVSEHKCVLNACRHLEQEGIKITYLPIKSNGIIDLETLKNAITDQTLLVSVMAVNNEIGVI 165 Rickettsia prow...
WP_011714616  79 LAIAGVAKFYKDKGNHIITPVTEHKAVLDTCRYLEQEGFEVTYLPVQKDGLVNMAELEAAITDKTVLVSIMAVNNEIGVI 158 Magnetococcus m...
O51886       161 QDITNISKICRSHDIFFHVDATQSVGKIAINLKNLFVDLMSFSAHKIYGPKGIGGLYVRRKPRVRLSALSHGGGHERGMR 240 Buchnera aphidi...
Q9JYY0       161 QDIPAIGEICRERKIIFHVDAAQACGKVPVDVEAAKVDLLSMSGHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGFR 240 Neisseria menin...
Q9HXI8       161 NDIAAIGELTRSRGVLFHVDAAQSTGKVEIDLDKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEGQMHGGGHERGMR 240 Pseudomonas aer...
P57803       161 QDIAAIGELCRARKILFHVDATQSVGKLPINLAELKVDLMSMSSHKLYGPKGIGALYVSRKPRVRLEAIIHGGGHERGMR 240 Pasteurella mul...
Q9ZD60       166 QPLKEIGKICRERNVFFHSDIAQGFGKIPINVNECNIDLASISGHKIYGPKGIGALYIRKKPRVRVTPLINGGGQERGMR 245 Rickettsia prow...
WP_011714616 159 QPLAQIGALCRRKKVFFHCDAAQGVGKMPIDVNEMNIDLMSISGHKIYGPKGIGALYVRRRPRVRVNAIIHGGGHERGMR 238 Magnetococcus m...
O51886       241 AGTLPVHQIVGMGESFKLARKKINDDFIHLTNLRNDLWNGIKN-IEEVYLNSDLKQGAPHILNVSFNYIEGESLIMALKD 319 Buchnera aphidi...
Q9JYY0       241 SGTLPTHQIVGMGEAFRIAKEELAQDTAHYLKLRDIFLKGIEG-IEEVYINGDLEHRVPNNLNVSFNFVEGESLIMAVKE 319 Neisseria menin...
Q9HXI8       241 SGTLATHQIVGMGEAFRIAKEEMAQENARVLALRDRFFAQIDG-LEELYINGSMTSRVPHNLNVSFNYVEGESLIMALKD 319 Pseudomonas aer...
P57803       241 SGTLPVHQIVGMGEAYRICKEEMASEMPRLKALRDRLYNGLKD-IEETYVNGSMEHRLDSNLNISFNYVEGESLMMALRD 319 Pasteurella mul...
Q9ZD60       246 SGTLPTPLIVGLGIASEIAYNEMEKDTQHVNYLFDRFLNNIHSkISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKD 325 Rickettsia prow...
WP_011714616 239 SGTLSTPLIVGLGEACRLATEEMVVEEARVLRLREKLRTALESqMTHVQTNGSLEHRIAGNLNISFEYVEGESMMMAIKD 318 Magnetococcus m...
O51886       320 LAISSGSACTSSSLEPSYVLRALGIKDELAHSSIRFSIGRFTTKEEIQHTVKSVHKSIHRLRALSPLWEMFKSGVDLNSI 399 Buchnera aphidi...
Q9JYY0       320 LAVSSGSACTSASLEPSYVLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSI 399 Neisseria menin...
Q9HXI8       320 LAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAKKVVEAVSKLRELSPLWDMYKEGVDLSQV 399 Pseudomonas aer...
P57803       320 IAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFTLGRYTTEEEIDYTIELVKNAVAKLRELSPLWDMFKEGIDLNTI 399 Pasteurella mul...
Q9ZD60       326 LAVSSGSACTSASLEPSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLVCSKIDKLRRLSPLWEMMQEGVDLKKI 405 Rickettsia prow...
WP_011714616 319 VAVSSGSACTSASLEPSYVLRSLGLNDEMAHTSIRFGLGRFTTEEEVDAVIKIVTGAVDKLREMSPLWEMVQEGIDLSSI 398 Magnetococcus m...
O51886       400 EWDHT 404 Buchnera aphidicola str. Sg (Schizaphis graminum)
Q9JYY0       400 EWAAH 404 Neisseria meningitidis MC58
Q9HXI8       400 EWQAH 404 Pseudomonas aeruginosa PAO1
P57803       400 EWTHH 404 Pasteurella multocida subsp. multocida str. Pm70
Q9ZD60       406 RWTAH 410 Rickettsia prowazekii str. Madrid E
WP_011714616 399 KWAEH 403 Magnetococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap