Conserved Protein Domain Family
PTS-II-BC-unk1

?
TIGR02003: PTS-II-BC-unk1 
PTS system, IIBC component
This model represents a family of fused B and C components of PTS enzyme II. This clade is a member of a larger family which contains enzyme II's specific for a variety of sugars including glucose (TIGR02002) and N-acetylglucosamine (TIGR01998). None of the members of this clade have been experimentally characterized. This clade includes sequences from Streptococcus and Enterococcus which also include a C-terminal A domain as well as Bacillus and Clostridium which do not. In nearly all cases, these species also contain an authentic glucose-specific PTS transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 131058
View PSSM: TIGR02003
Aligned: 2 rows
Threshold Bit Score: 966.735
Threshold Setting Gi: 29894163
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAP07454       2 KITSFDFWQKFGKALLVVVAVMPAAGLMISIGKLIGMSAGDVNAVHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDRA 81  Bacillus cereus...
WP_011018257   7 QLFRFEFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERA 86  Streptococcus p...
AAP07454      82 GGAFAALLAFVLTNRITGAIFGVNAEMLADSKAKVSSVIAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNRYY 161 Bacillus cereus...
WP_011018257  87 GGAFASGLAFVLINRITGAFYGVSSAMLADPEAKITSFLGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYY 166 Streptococcus p...
AAP07454     162 NYDRLPQALAFFNGKRFVPFVVILWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPVVAPFVYGTLERLLLPFGLHH 241 Bacillus cereus...
WP_011018257 167 NYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHH 246 Streptococcus p...
AAP07454     242 MLTIPMNYTELGGTYTMLTGSKVGQVVAGQDPLWLAWITDLNNLLANgDTKAYNDLLNNVVPARFKAGQVIGSTAALMGI 321 Bacillus cereus...
WP_011018257 247 MLTIPMNYTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGS-DASAYSHLMDSVTPARFKVGQMIGATGTLMGI 325 Streptococcus p...
AAP07454     322 AFAMFRNVDKEKRAKYKPMFLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELITR 401 Bacillus cereus...
WP_011018257 326 ALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYIVYALVQGASFAMADLVNLRVHSFGNIELLTR 405 Streptococcus p...
AAP07454     402 TPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNY-IDNEDE-ASEGTGNVQD--GSLATKVIDLL 477 Bacillus cereus...
WP_011018257 406 TPMALKAGLGMDVINFVWVSILFAVIMYFIADMMIKKMHLATAGRLGNYdADILGDrNTQARPTQVAdsNSQVVQIINLL 485 Streptococcus p...
AAP07454     478 GGKENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGLIVKDKGVQAVYGPKADVLKSDIQDMLGA 545 Bacillus cereus ATCC 14579
WP_011018257 486 GGAGNIDDVDACMTRLRVTVKDPAKVGAEDDWKKADAMGLIQKGNGVQAVYGPKADVLKSDIQDLLDS 553 Streptococcus pyogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap