2D2A


Conserved Protein Domain Family
sufA_proteo

?
TIGR01997: sufA_proteo 
Click on image for an interactive view with Cn3D
FeS assembly scaffold SufA
This model represents the SufA protein of the SUF system of iron-sulfur cluster biosynthesis. This system performs FeS biosynthesis even during oxidative stress and tends to be absent in obligate anaerobic and microaerophilic bacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131052
View PSSM: TIGR01997
Aligned: 5 rows
Threshold Bit Score: 189.27
Threshold Setting Gi: 29541920
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D2A_A               39 QGLTLTPAAAIHIRELVAKQP-GMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFE-HDGAKLFVPLQAMPFIDGTEVD 116 Escheric...
P77667               16 QGLTLTPAAAIHIRELVAKQP-GMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFE-HDGAKLFVPLQAMPFIDGTEVD 93  Escheric...
WP_011950191         47 AVITLTDAAANRVHEIMTSRE-DALGIRVGVKKGGCAGMEYTIELVTEAKAGDDLIE-KDGAKVFIAPEAVLFLLGTQMD 124 Brucella...
lhbprmlnih:CBU_1355   6 TIIEFTKAAYTHIQSLIKKRT-EHSFFRLSIKKTGCSGYMYQPEIVENPKENDVLMKtAIGLSVAIDPKCLHMIKGTVVD 84  Coxiella...
WP_010969428          4 AVMSLTDAAASRVRSIVENAGgEAKGIRISIKKGGCAGMEYAVDLVSEPNSKDDLIE-QQGAKVWVAPEAVLYLLGTQMD 82  Sinorhiz...
2D2A_A              117 FVREGLNQ-IFKFHNPKAQNECGCGESFGV 145 Escherichia coli
P77667               94 FVREGLNQ-IFKFHNPKAQNECGCGESFGV 122 Escherichia coli K-12
WP_011950191        125 FEVTTLRT-GFVFNNPNQTSACGCGESVEL 153 Brucella ovis
lhbprmlnih:CBU_1355  85 YVKKDLGQyQLHFNNPNAIGACGCGESFHL 114 Coxiella burnetii RSA 493
WP_010969428         83 FETTTLRS-GFTFNNPNQTSACGCGESVEL 111 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap