Conserved Protein Domain Family
PTS-II-BC-sucr

?
TIGR01996: PTS-II-BC-sucr 
PTS system, sucrose-specific IIBC component
This model represents the fused enzyme II B and C components of the sucrose-specific PTS sugar transporter system. Sucrose is converted to sucrose-6-phosphate in the process of translocation into the cell. Some of these transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci, Streptococci, Lactococci, Lactobacilli, etc. which contain their own A domain as a C-terminal fusion. This family is closely related to the trehalose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively).
Statistics
?
PSSM-Id: 131051
View PSSM: TIGR01996
Aligned: 15 rows
Threshold Bit Score: 563.847
Threshold Setting Gi: 4091870
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD62855       2 NHQEVADRVLNAIG-KNNIQAAAHCATRLRLVIKDESKIDQQALDDDADVKGTFETNGQYQIIIGPGDVDKVYDALIAKT 80  Lactobacillus p...
CAA68605       2 DFEQISCSLLPLLGgKENIAS-AALATRLRLVLVDDSLADQQAIGKVEGVKGCFRNAGQMQIIFGTGVVNKVYAAFTQAA 80  Salmonella ente...
P15400         1 MHKEIAKELLLLAGgKNNIISISHCTTRLRFDVKDETKIDIHAIENLQGVQGTFFRYGLFQIIFGAGVVNKIYKEVVHVW 80  Bacillus subtil...
AAC99320       2 KEQIVAKEILENIGgKENIKSVEHCATRLRLILNDKEKINEKAIENIDGVKGQFFSAAQYQIILGTGFVNEVYDVIVGQ- 80  Clostridium bei...
WP_001108116   2 NYKQSAEDILNAIGgEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQYQIIIGSGTVNKVFSELEKLT 81  Staphylococcus ...
WP_018030701   2 DNKQIAKEVIEALGgRDNVRSVAHCATRLRVMVVDEAKIDKERAENIDKVKGAFFNSGQYQIIFGTGTVNKIYDEVVDL- 80  Streptococcus f...
WP_010963745   2 DYNKTAKDILKLLGgEKNVMSAAHCATRLRLVLKNEKEARTKEIEKLDGVKGVFSSSGQYQIIIGQGSVNKVYKAFVEGT 81  Clostridium ace...
WP_010898017   2 NHQEVVKQLIPLLGgRENIVSGTHCATRLRIVLKDDQLAQTKEIEQLDGVKGAFLSSGQYQIIFGTGVVNKVYAAFAEET 81  Bacillus halodu...
WP_016726255  17 NEQETAQALLPLLGgPDNVVSLAHCATRLRLVVRDAAKVDHGAITALALVKGAFSNAGQVQIVIGQGTVNRVHDALQPLL 96  Ralstonia solan...
WP_010922624   2 DNRQIAAEVIEALGgRENVRSVAHCATRLRVMVYDEGKIDKEKAEAIDKVKGAFFNSGQYQMIFGTGTVNNIYDEVVAL- 80  Streptococcus p...
CAD62855      81 G-LKEATPDDIKAVAAAgqKKNPLMDFLKVLSDIFIPIVPALVAGGLLMALNNVLTAEHLFMAk-SVVEVYPGLKGIAEM 158 Lactobacillus p...
CAA68605      81 G-ISESSKSEAADIAAK--KLNPFQRIARLLSNIFVPIIPAIVASGLLMGLLGMVKTYGWVDP-------G---NAIYIM 147 Salmonella ente...
P15400        81 E-TAPSEEPVHQKKASR--KLNPAAAFAKTLSDIFVPIIPAITASGLLMGLIGMIKVFHWFAA-------G---SPWIKM 147 Bacillus subtil...
AAC99320      81 --NSDLVTGNNKEEAYs--QMTLIQKISRTFGDVFVPIIPVLVATGLFMGLRGLLTN--------LGVQ---MNENFVLF 145 Clostridium bei...
WP_001108116  82 G-KEASTTSEVKAQSAK--NMNPLQRFVKMLSDIFVPIIPAIVAGGLLMGLNNILTAKDLFFSgkSLIDVYSQFAGLAEM 158 Staphylococcus ...
WP_018030701  81 G-LPTSSTGEQKQEAAA--QGNWFQRMSRTFGDVFVPIIPVLVATGLFMGLRGLLTNDTFLGF--FGASSKDINANFILY 155 Streptococcus f...
WP_010963745  82 G-ISESSLSDTKKAAMK--NMNLFERFARMLSNIFVPIIPAIVASGLLMGLLGMLDAFHLVNS--K--------SGLYVI 148 Clostridium ace...
WP_010898017  82 G-LKEGNQEDHQEAVKK--KMNPIARFAKTLSNIFVPIIPAIVASGLLMGLLGMMRTFEWVAP----------DHALIVL 148 Bacillus halodu...
WP_016726255  97 NsTAAASLEDVKREATT--RLNPVQRLARTLSDIFVPIIPVIVASGLLMGVLGMLRSMGWAEG--S--------NALFQI 164 Ralstonia solan...
WP_010922624  81 G-LPTSSTSEQKAEAGK--HGNIFQRAIRTFGDVFVPIIPAIVATGLFMGVRGLVTQPAIMDL--FGVH--EYGENFLMY 153 Streptococcus p...
CAD62855     159 INAMASAPFTFLPILLGFSATKRFGGNPYLGATMGMIMVLPSLVNGYSVATTMAAGKMv-yWNVFGLHVAQAGYQGQVLP 237 Lactobacillus p...
CAA68605     148 LDMCSSAAFIILPILIGFTAAREFGGNPYLGATLGGILTHPALTNAWGVAAGFHT------MNFFGFEIAMIGYQGTVFP 221 Salmonella ente...
P15400       148 LDLVSSTAFILLPILVGFSAARQFGSNPYLGAVIAGLLTHPDLLDPSMLGSKTPSS-----LDIWGLHIPMMGYQGSMIP 222 Bacillus subtil...
AAC99320     146 TQVLTDTAFAFLPALVAWSTMKKFGGTPVIGIVIGLMLVSPSLPNAYAVAAGTATPIN---LTILGLNIPVVGYQGSVLP 222 Clostridium bei...
WP_001108116 159 INVFANAPFTLLPILIGFSAAKRFGGNPFLGAVLGMILVHPSLMSAYDFPKAVEAGKAipyWDVFGLHINQVGYQGQVLP 238 Staphylococcus ...
WP_018030701 156 TQVLTDTAFAFLPALIAWSSFKVFGGNPVLGIVLGLMMVNPALPNAYAVASGDA--KA---LTFFGF-IPVVGYQGTVLP 229 Streptococcus f...
WP_010963745 149 LNMFSNAAFQFLPMIIAFSAAREFKTNPYLAAALGAIMIHPDLQNAWTLGEGIKHT-----INIFGLNIGMVGYQGTVLP 223 Clostridium ace...
WP_010898017 149 LDMFSSAAFIILPILIGVSAAKEFGGNPYLGAVMGGIMTHPALLNPWGLGNAEPDY-----LTFLGFDIALIGYQGTVIP 223 Bacillus halodu...
WP_016726255 165 FDIFASTAFVFLPILIAFSAGKSFGVSPFLAAALAGILIHPALQNAWTLGSGVREY-----WDLFGVPVAKVGYQGTVLP 239 Ralstonia solan...
WP_010922624 154 TRILTDTAFVYLPALVAWSAFRVFGGNPIIGIVLGLMLVSNELPNAWVVASGGDV-KP---LTFFGF-VPVVGYQGTVLP 228 Streptococcus p...
CAD62855     238 VLAVAYILATLEKFFHKHIKGAFDFTFTPMFAIVITGFLTFTIVGPVLRTVSDALTNGLVGLYNTTGWIGMGIFGLLYSA 317 Lactobacillus p...
CAA68605     222 VLLAVWFMSIVEKQLRRAIPDALDLILTPFLTVIISGFIALLIIGPAGRALGDGISFVLSTLISHAGWLAGLLFGGLYSV 301 Salmonella ente...
P15400       223 ILLSVFVMSKIEKLLKSIVPKSLDVVIIPFITVMVTGCLALIVMNPAASIIGQIMTQSIVYIYDHAGIAAGALFGGIYST 302 Bacillus subtil...
AAC99320     223 ALVLGIIAAKTQKALKKVVPDVLDLIVTPFITLLFSMVLGLLIVGPIMHNAEQLIFGAIKGFMGLPFGLGGLVVGGVHQL 302 Clostridium bei...
WP_001108116 239 MLVAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWLYEFGGAIGGLIFGLLYAP 318 Staphylococcus ...
WP_018030701 230 AFFVGMIGARLENWLHKRVPEALDLLITPFLTFLVMSILGLFAIGPVFHSVETVVLAATEWILALPFGIAGIIIGGLQQV 309 Streptococcus f...
WP_010963745 224 ILISVWVMSYIEKGLRKIVPEALDILLTPFLTLMITGFFAMVVIGPGGRFVGDEISLGLQTLYNTTGFFSGVLFGGLYSL 303 Clostridium ace...
WP_010898017 224 VLLAVYAMSKIEKGLRKVVPNAIDLLVTPFVTIMLTGFISLMVIGPIGNFIGDGITTILNFVYDHVGFVAGLLFGGIYSA 303 Bacillus halodu...
WP_016726255 240 VLFAVWIMARIERLVRRVVPTGVDLIFTPFLTLLISGAIALTVVGPIGRALGDALSFGLQWVYQHGGPLAGLVFGGLYSA 319 Ralstonia solan...
WP_010922624 229 AFFVGLVGAKLEKWLHKKVPEALDLLVTPFLTFAIMSTLGLFVIGPVFHSLENLVLAGTQAVLHLPFGIAGLIVGGIQQL 308 Streptococcus p...
CAD62855     318 IVITGLHQTFPAIETQLLAN-VAkTGGSFIFPVASMANIGQGAATLAIFFATK-SQKQKALTSSAGVSALLGITEPAIFG 395 Lactobacillus p...
CAA68605     302 IVITGIHHSFHAVEAGLLGN-PS-IGVNFLLPIWAMANVAQGGACLAVWFKTK-DAKIKAITLPSAFSAMLGITEAAIFG 378 Salmonella ente...
P15400       303 IVLSGLHHSFYAIEATLLAN-PH-VGVNFLVPIWSMANVAQGGAGLAVFLKTK-QSSLKKIALPASLTAFLGIVEPIVFG 379 Bacillus subtil...
AAC99320     303 IVVTGVHHALNALEVELLSS-TG---KDAFNAMITCGIVAQGAAALAVAVKTK-DKKKRSLYISSAIPAFLGITEPAIFG 377 Clostridium bei...
WP_001108116 319 IVITGMHHSFIAVETTLIADaTK-TGGSFIFPIATMSNVAQGGAAIAAFFIIKqNKKLKGVASAAGISALLGITEPAMFG 397 Staphylococcus ...
WP_018030701 310 IVVTGVHHIFNFLETQLLAE-TK---ANPFNPLLSAATAGQVGAVLAVAVKTK-SAKLKALAYPSALSAALGITEPAIFG 384 Streptococcus f...
WP_010963745 304 IVITGIHHSFHAIEAGLLAN-PA-IHKNFLLPIWSMANVAQGGAALAVYFKTR-DKKMKSIAAPASFSCLLGITEPAIFG 380 Clostridium ace...
WP_010898017 304 IVITGVHHSFHAIEAGLIAS----IGINYLLPIWSMANVAQGGAGLAVFFKTK-RAKTKEVALPSAFSAFLGITEPVIFG 378 Bacillus halodu...
WP_016726255 320 IVVTGVHHSFHAIEAGLLAN-PS-IGVNFLLPIWSMANIAQGGAALAVFSVSR-DDKIRQIALPAALSCLMGITEAAIFG 396 Ralstonia solan...
WP_010922624 309 IVVTGIHHIFNFLEAQLIAN-T---GKDPFNAYLTAATAAQAGATLAVAVKTK-STKLKGLAFPSTLSALLGITEPAIFG 383 Streptococcus p...
CAD62855     396 VNLKMKFPFVFAAIASGIASAFLGLFHVLSVAMGPASVIGFISIASKS-IP--AFMLSAVISFVVAFIPTFIY 465 Lactobacillus plantaru...
CAA68605     379 INLRFVKPFIAALIGGAAGGAWVVSVHVYMTAVGLTAIPGMAIVQAS---SllNYIIGMVMPLASPLRCSLVL 448 Salmonella enterica su...
P15400       380 VNLKLIRPFIGAAIGGAIGGAYVVAVQVVANSYGLTGIPMISIVLPFGaANfvHYMIGFLIAAVSAFIATLFL 452 Bacillus subtilis subs...
AAC99320     378 VNLRFIKPFIFGCAGGAVGGMLSGILHLAGTGMGITALPGMLLYVN----NlgSYILVNVVAIAVAFCLTLFF 446 Clostridium beijerinck...
WP_001108116 398 VNLKLRYPFIGAIVGSGIGSAYIAFFKVKAIALGTAGLPGFISINPVH-AGwlHYFVGMTISFIIAITVTLIL 469 Staphylococcus aureus
WP_018030701 385 VNLRYGKPFVMGLVGGSAGGFIAALVGLKATGMSVTVLPGLLLFLNS---QmpMYIVSITVACAIAFALTYYF 454 Streptococcus ferus
WP_010963745 381 VNLRYTKPFIAGALGGAIGGGYIVFTKVAMTAVGVTGIPGIAIVKQG---SflNYIIAMILAFGGAFIIAMVL 450 Clostridium acetobutyl...
WP_010898017 379 VNLKYRRPFVGAMIGGALGGAYVVFMNVSAVAYGLTGIPMLAIVSPLGtINllHYVIGFFIALVTAFVATWLL 451 Bacillus halodurans
WP_016726255 397 INLRFFRPFIAAAVGGAVAGGWVVATHVGMTGIALTGFPGLAIVQPG---SlvNYLIGAGIAFSVAFVCARLa 466 Ralstonia solanacearum
WP_010922624 384 VNLRYPKVFVSGLIGGALGGWVAGLFGIAGTGFGITVLPGTLLYLNG---QllQYLVTMLVGLGVAFAIAYTW 453 Streptococcus pyogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap