Conserved Protein Domain Family
phasin_2

?
TIGR01985: phasin_2 
phasin
This model represents a family of granule-associate proteins (phasins) which are part of the polyhydroxyalkanoate synthesis machinery. This family is based on a pair of characterized genes from Methylobacterium extorquens. Members of the seed for this model all contain the rest of the components believed to be essential for this system (see the "polyhydroxyalkanoic acid synthesis" property in the GenPropDB). Members of this family score below trusted to another phasin model, TIGR01841 and together may represent a subfamily or broader equivalog.
Statistics
?
PSSM-Id: 131040
View PSSM: TIGR01985
Aligned: 10 rows
Threshold Bit Score: 101.309
Threshold Setting Gi: 24430940
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAN61321              7 EIPAEFREFADKSVDQARNAFGTFLNGAVKTSEQLRNSATTVQSTLNAAVLKSLDHTKTNADAAFDYVQRVVRAKDPREA 86  Methylob...
AAN61322              8 EVPTEMRDFAEKSVEQARKAFDSFIGAARRTADTVQGSTDLARSNATSISSRGFEYAEQNVNAAFDLAQKLVRSRDVQEA 87  Methylob...
BAC51394              7 EVPAELRDLAEKTIDQAEQAFGMFFDAATKSMSSVPGAG-------TEVSKQALAFTEQNMKSAFEHARKLVHATDLQEA 79  Bradyrhi...
BAC48729              1 --MAEINPSAENIRGMLTEALVRLRKANAEYFELLERGLSSSPLPIADQAKQFCSFMQRNASATFDFGDKLVQAKDVQDA 78  Bradyrhi...
retlidb:RHE_PD00301  21 KVPDQFGASVEKGNKKVTEAFLKLASGAEATQKMLPPILETTSLFGNELWWKTIAALQADAEASFSHLQALLGANSPSQI 100 Rhizobiu...
BAC52660             16 EVPEQVRAFAEKGVSQARESYAKFKDAAESHNGTIEAVFSSASKGANEYTAKLMEFMKANTTAHLDFTQELLGVKSPSDA 95  Bradyrhi...
BAC50820             33 NIQAIFGDLAAPAATRAKANFEQMKVTSEEITAALCDACSTSAKRSADYGTKVIEISNANTSSALEFFSQLADARSFADL 112 Bradyrhi...
BAC48152             23 EVPEAAREFVKKTANTAKDRAAEVFAGSERVTAAVENAVTESVTEAGKISRNIQQAIYEDAEAFFSGIDKLASAKSFSEA 102 Bradyrhi...
WP_010914126         22 KATDQIRAFAEKGVEQSKEAYAKLKTGAEETQKALESTYETAKTVSSDLSLKTIAALRANAEAGFSHLEALIGAKSLSEV 101 Mesorhiz...
WP_011646048         16 RPTEAATKTIESGMDTMAGIASKFSGYTEDGVKALKDSAALSTETMREIGSRNMNFMTQAMEQGVELTQALASARDPREM 95  Hyphomon...
AAN61321             87 FEIQSEFLKTQFAAFQAQAKEYG-ALAQSAAGR 118 Methylobacterium extorquens
AAN61322             88 MQHQAEFVRAQFAAIQAQAKEFG-GLAQSAFQQ 119 Methylobacterium extorquens
BAC51394             80 MRIQSDFLRSQFTSAGDHMRQMTgSLMQPGKGK 112 Bradyrhizobium diazoefficiens USDA 110
BAC48729             79 LKLQSEFFQGQMQALTDQARSMG-ESAMKAATG 110 Bradyrhizobium diazoefficiens USDA 110
retlidb:RHE_PD00301 101 LEQQSTFFRKRVETSLQHAKEVR-VLSSRAVEE 132 Rhizobium etli CFN 42
BAC52660             96 FALWSSHGKKQLETFQAQAKELA-EIAQRAATA 127 Bradyrhizobium diazoefficiens USDA 110
BAC50820            113 VNLSTAHGRKTFEAASAQNRELW-DLAQKVATE 144 Bradyrhizobium diazoefficiens USDA 110
BAC48152            103 VEIQSSLLRSRGEAFVSRAKATT-DYLGKLAAN 134 Bradyrhizobium diazoefficiens USDA 110
WP_010914126        102 VELQTAFLRKRVELTVEQAKDFQ-AVASKAAEE 133 Mesorhizobium loti
WP_011646048         96 FQIQSGYAKSMFSAYTAEFTAQS-ELCMGAWRE 127 Hyphomonas neptunium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap