Conserved Protein Domain Family
sufB

?
TIGR01980: sufB 
FeS assembly protein SufB
This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131035
View PSSM: TIGR01980
Aligned: 10 rows
Threshold Bit Score: 728.009
Threshold Setting Gi: 499382593
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q55790        12 QPYKYGFVTNIE-ADAIPRGLSEDVVRLISAKKNEPEFMLDFRLRAYRHWLTMAEPT-WPa-VHYPPIDYQDIIYYSAPk 88  Synechocystis s...
WP_011066768   9 DEYKYGFHDKDVsIFRTEKGLTPRVVEEISKMKEEPEWMLEYRLKSLEHFYNRPMPQ-WG--GDLSGLDFDEIVYYVKP- 84  Oceanobacillus ...
WP_002263153   4 RDYAFGFHDDVKpLYSTGKGLTEEVVRDISEIKNEPQWMLDYRLRCLELFYKLPMPK-WG--PDLSGINFNDVIYYQKL- 79  Streptococcus m...
WP_015713456  42 GDYNYGWHDSDAaGEAAKRGIDENVVRAISADKGEPQWMLDMRLRGFKAFLEKPMPD-WG--VDLSGFNADDFKYYVKP- 117 Bifidobacterium...
WP_011026664  10 DFSIYNIKDEVEyEFQTGKGLSKEVVLEISEQKGEPSWMREFRLKALEIYEKMPMPT-WG--VDLSQLDINSIVAYIRP- 85  Caldanaerobacte...
WP_010900630  23 GSLDYGFHDNINpVYSTGKGLSRQVVEEISEIKKEPDWMRRIRLHAYEIFMSKPVPT-WG--PDLSGIDWENMTYYSRP- 98  Thermoplasma ac...
WP_010966563  12 eRGVYDIKNEDRySYKVNKGLTPEIIEKISKEKHDPKWMLDFRLKCLDVYNKTELPS-WG--PSLDELDMDNIVTYVRP- 87  Clostridium ace...
WP_010902348  11 TEARFEFKKEENsAFESEKGLTEETIRVISEDKDEPDWMLDRRLRALEQYTKMPMPTdWPgqPDLTELDIEEIVPYIRP- 89  Halobacterium s...
WP_011070164  37 TDYKEGFSTILK-TEELEHGINEKVVKDISEKRQEPEWMLRFRLKAYDAWTKMKEPH-WLn-GKFENIDYNKYIYYSAP- 112 Wigglesworthia ...
WP_011008219  17 vEEVLGIEKKFSyQVELKGRITKDMVEEISRLKGEPDWMRRLRLRMLELFEKLPTPK-WV--RAVQEIDLEALVHYAKP- 92  Pyrobaculum aer...
Q55790        89 qS-------KKK---LESLDEVDPALLETFEKLGIPLSEQKRL-SNvaVDAIFDSVSIGTTFKEKLAEDGVIFCSISEAL 157 Synechocystis s...
WP_011066768  85 -S-------EKQ---GRTWDEVPEEIKQTFDKLGIPEAEQKYL-AG--VSAQYESEVVYHSLKEDLQDLGIIFKDTDTAL 150 Oceanobacillus ...
WP_002263153  80 -S-------GQP---SRSWDDVPDDIKKTFERLGIPNAERQFL-SG--AVAQYESEVVYHNMKEEFEKMGIIFTDTDTAL 145 Streptococcus m...
WP_015713456 118 -I-------DKQ---AKSWDELPDDIRNTYDRLGIPEAEKNRLvSG--VAAQYESEVIYNSIQEDLKKQGVIFVDTDTAV 184 Bifidobacterium...
WP_011026664  86 -S-------ARK---KTSWEEVPEEIRRTFERLGIPEAEKKAL-AG--VGAQYDSEVIYHNMKESLARQGVIFEDMDTAL 151 Caldanaerobacte...
WP_010900630  99 -D-------EVK---ATNWDEVPKEIKDTFEKLGVPEMERKYL-AG--SIAQYDSEGIYNSIKKEWEEKGVVFMDLDSAL 164 Thermoplasma ac...
WP_010966563  88 -D-------TEM---KGSWNEVPDDIKDTFEKLGIPKAERESL-AG--VGAQYDSEVVYHSIKEDLVKQGVIYTDMETAI 153 Clostridium ace...
WP_010902348  90 -D-------VDKrsgADEWEDLPDEIQDTFEQLGIPEAERNAL-SG--VGAQYESEVVYQNMQERWEEKGVVFCNMDEAV 158 Halobacterium s...
WP_011070164 113 -DcnefkkeKKN---NNNTKYLTKEVKNTFNKLGIPTSEKNNI-A---IDAIFDSVSVSTTYQKFLKKIGIIFCSFSDAI 184 Wigglesworthia ...
WP_011008219  93 -Q-------TET---VSSWDQLPKEIREYYEKLGLPEIEAKAL-LG--LGAQFDSEIIYFNLKKKLQEKGVIMLPMEEAV 158 Pyrobaculum aer...
Q55790       158 QEHPDLVQKYLGSV-VPTADNFFAALNSAVFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIIAEEGASVSYLE 236 Synechocystis s...
WP_011066768 151 KENEELFKEYFGKV-IPYSDNKFSALNSAVWSGGSFIYVPKGVEATTPLQAYFRINSENMGQFERTLIIVDEGASVHYVE 229 Oceanobacillus ...
WP_002263153 146 QEYPDLVKKYFASV-VSPAEHKFAALNGAVWSGGTFIYVPKGVQCQIPVQTYFRINGENAGQFERSLMIIEEGASIQYIE 224 Streptococcus m...
WP_015713456 185 REYPELVKKYFGTV-VPPEDNKFGALNTAAWSGGSFVYVPKGVHVDIPLQAYFRINTPAMGQFERTLIIADEGSYVHYVE 263 Bifidobacterium...
WP_011026664 152 KKYPDIIREYFMTKnVLPTDHKFAALHAAVWSGGTFVYVPEGVKVEVPLQAYFRMNAPGSGQFEHTLIIADRGSEVHFIE 231 Caldanaerobacte...
WP_010900630 165 KRYPDLVKEYFAKA-VPPSDNKFAALNVAVWSGGAFLYVPRGVHVDMPLQTYFRINGEATGQFEHTIVVADEGSSVHYLE 243 Thermoplasma ac...
WP_010966563 154 NKYEDIVKEYFMKL-VPPSDHKFVALHGAVWSGGSFVYVPEGVNVDIPLQSYFRLNSPGAGQFEHTLIIVEKGATLHFIE 232 Clostridium ace...
WP_010902348 159 QEYPELVKEHFMTScVPPSDNKFAALHGAVWSGGSFVYVPEDVTVNMPVQAYFRMNSEGMGQFEHTLIIAEEGSEVHYIE 238 Halobacterium s...
WP_011070164 185 KKYPKLVKEYLGSV-VPVNDNFFAALNSAVASDGTFIYVPKGVRCPMELSTYFRINSANTNQFERTILIADEFSYISYIE 263 Wigglesworthia ...
WP_011008219 159 RKYPDLVQRYFMRV-FPP-EHKFAALHGALWSGGVFIYVPPGVRIEQPLETFFFIGQSMESQMEHSIVVADKDAYVHWIE 236 Pyrobaculum aer...
Q55790       237 GCTAPMYDTNQLHAAVVELVALDNADIKYSTVQNWYAGdengkggIYNFVTKRGLCKgVNSKISWTQVETGSAITWKYPS 316 Synechocystis s...
WP_011066768 230 GCTAPVYTTNSLHSAVVEIIVKKDAYCRYTTIQNWANN-------VYNLVTKRATCD-ANATMEWIDGNIGSKLTMKYPA 301 Oceanobacillus ...
WP_002263153 225 GCTAPTYSTNSLHAATVEIIVKRDASFRYTTIQNWSDN-------VYNLVTERGTVE-ENGTLEWIDGNLGSKVNMKYPC 296 Streptococcus m...
WP_015713456 264 GCTAPIWSEDSLHAAIVEIIVEKHARVRYTTVQNWSNN-------VYNLVTQRAYVR-EGGTMEWVDGNIGSKATMKYPA 335 Bifidobacterium...
WP_011026664 232 GCSAPLYSVSNLHAGCVELFVKEGARIIYSTIENWSKN-------TYNLNTKRAIVE-RDGMVEWISGSFGSKKTMLYPA 303 Caldanaerobacte...
WP_010900630 244 GCTAPVYSKDSLHAAIVEYYVMKNAHGRYTSVQNWSNS-------VYNMPTKRAWVE-ENGNMEWVGGSLGSKVTMIYPS 315 Thermoplasma ac...
WP_010966563 233 GCSAPKYNVTNLHAGCVELYVKEDATLRYSTIENWSKN-------MLNLNTKRAVVE-KNGTIEWVSGSFGSKISMLYPM 304 Clostridium ace...
WP_010902348 239 GCSAPKYGSHNLHSGGVEVFVGEDAHVQYSTVQNWSKN-------TFNLNTKRAVVE-GNGTMEWVSGSMGSKATMLYPS 310 Halobacterium s...
WP_011070164 264 GCSAPIRNNYQLHAAVVEVILLNNARVKYSTVQNWFPGkkn-kggILNFVTKRALCKgKESKMSWTQSETGSAITWKYPS 342 Wigglesworthia ...
WP_011008219 237 GCSAPRLLKYSFHNGMVEGYAHEGATLKITTVQNWSRN-------VVNFNNKRAIAE-ARAKVHWVEGSIGSKTTYTFPS 308 Pyrobaculum aer...
Q55790       317 CVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSIIISKGISAGNSANSYRGLVKMGPKAQGARNYSQCDSMLIG 396 Synechocystis s...
WP_011066768 302 ILLKGEGARGNTLSIALAGKGQLQDAGAKMHHLAPNTSSTIVSKSISKQGGKVSYRGLVHFGRKADGARANIECDTLIMD 381 Oceanobacillus ...
WP_002263153 297 SILNGRQARTSVLSMSFANYGQHLDAGCKVYHNAPRTSSTLISKSVAKDGGKTDYRGSVTFGKNSAGSKSHIECDTILMD 376 Streptococcus m...
WP_015713456 336 CILAEPYAKASTMSLGFAGKGQYQDTGAKMIHLAPHTSSTIVAKSISRGGGRSAYRGLVKIVKGAYGSSNSTVCDALLVD 415 Bifidobacterium...
WP_011026664 304 SVLVGKGAKAEYTSITFAAKGQHLDTGAKMIHLAPYTSSKILAKSISKDGGISTYRGLLKVGPEAEGVKASVTCEGLMLD 383 Caldanaerobacte...
WP_010900630 316 SYLRGRNATTSNLNIALAGPGTVKDTGAKAIHMAPNTSSKIIAKSVSLGDGKSIYRGLVRINKDAVNAKSHVQCDALLIN 395 Thermoplasma ac...
WP_010966563 305 SILKGEGAKSEYTGVTFAGEGQHLDTGTKVVHAAPYTSSTISAKSISKGGGTCIYRGSVKVTENAHHCKSSVSCDSLMLD 384 Clostridium ace...
WP_010902348 311 TILKGRGATDNHITIAFAGDGQDIDTGAKVYHNAPDTSSTIESKSIAKDGGRTNYRGLVHIADGAEDSKTNVECDALMFD 390 Halobacterium s...
WP_011070164 343 VILKGDKSVGEFFSIALTKSYQQADTGTKMIHIGKDTKSTIISKTISSGKSNNTYRGLVKILPLAKNSRNFTQCDSMLIG 422 Wigglesworthia ...
WP_011008219 309 TVLKGEGASTEIVGITAAKGTYWKENGAKVWHLAPRTSSRVVNKSISAEGGVAVYRGIVHVQRGAKYAKSHVQCDSLVLD 388 Pyrobaculum aer...
Q55790       397 DRAAANTFPYIQVDNNTAKVEHEASTSKIGEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLL 471 Synechocystis sp. PC...
WP_011066768 382 NESTSDTIPYNEILNDNISLEHEAKVSKVSEEQLFYLMSRGLSEEEATEMIVMGFIEPFTKELPMEYAVEMNRLI 456 Oceanobacillus iheye...
WP_002263153 377 GESSSDTIPFNEIHNSDVSLEHEAKVSKVSEEQLYYIMSRGISEEEATAMIINGFMDPITKELPMEYAVELNALI 451 Streptococcus mutans
WP_015713456 416 DFSRSDTYPHVDVREDDVSMAHEATVSKISEDQLFYLMSRGLTEEEARGMIVRGFVEPISRELPMEYALELNRLV 490 Bifidobacterium longum
WP_011026664 384 DISKSDTIPVIDIENDNVDIGHEAKVGRISEEQIYYLMSRGLNEEDARAMIVRGFVEPIAKALPLEYAVEMNRLI 458 Caldanaerobacter sub...
WP_010900630 396 DESVSYTMPHDEIYEPTANFTHEATVGKIGTEELTYLRSRGLSEDEASSLIVLGFLDDVMKEIPMEFAVEMNRLV 470 Thermoplasma acidoph...
WP_010966563 385 DISQSDTIPALDLANDEVDIGHEAKIGRISDDAIFYLMSRGVSEDEARAMIVRGFVNPISKALPLEYAVEMNNLI 459 Clostridium acetobut...
WP_010902348 391 NDSTSDTMPYMEINESKVDVAHEATVGKIGDEDVFYLQSRGLDDDDAKQMIVSGFIEPITEELPIEYAVELNRLI 465 Halobacterium salinarum
WP_011070164 423 SNCGAHTFPYIEVFNKKSNIEHEATTSKIEENQIFYCQQRGIKVEDAISMIVNGFCKEIFSKLPLEFAIEAQKLL 497 Wigglesworthia gloss...
WP_011008219 389 KDSATLTVPHDQVFEETAVVTHEATASTISEEKLAYLRARGFTEDDAKAAIVLGFVGDILKDLPFEYAVVLGRVI 463 Pyrobaculum aerophilum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap