1T3I,1JF9


Conserved Protein Domain Family
sufS

?
TIGR01979: sufS 
Click on image for an interactive view with Cn3D
cysteine desulfurases, SufSfamily
This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131034
View PSSM: TIGR01979
Aligned: 19 rows
Threshold Bit Score: 594.634
Threshold Setting Gi: 13431405
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T3I_A        11 ATVRQDFPILNQEING-HPLVYLDNAATSQKPRAVLEKLMHYYENDNANVHRGAHQLSVRATDAYEAVRNKVAKFINARS 89  Synechocystis sp.
Q9Z7L5         2 KNLKEDFPIFAAKAKEnEPFIYLDSAATTQKPQQVIDAVANFYTSSYATVNRAIYSSSRNVTEAYAAVREKVRKWVSAAS 81  Chlamydia pneum...
O84693         2 YNVKKDFPIFKNQG---DPYVYLDSAATTHKPQCVIDSIVDYYSSSYATVNRALYTASHDITFAHWQVRSKVGSWIGAQY 78  Chlamydia trach...
Q9X191         4 TGLYEDFPTLKMKING-KRIVYLDSAATTLKPKQVVKKLEEFYYNSYANVHRAVHTLAVRATTEFEETREEFAEFLGAS- 81  Thermotoga mari...
O53155        11 AAIRADFPILKRIMRGgNPLAYLDSGATSQRPLQVLDAEREFLTASNGAVHRGAHQLMEEATDAYEQGRADIALFVGADT 90  Mycobacterium t...
O32164         4 TDIREQFPILHQQVNG-HDLVYLDSAATSQKPRAVIETLDKYYNQYNSNVHRGVHTLGTRATDGYEGAREKVRKFINAKS 82  Bacillus subtil...
WP_011026662   5 KKIREDFPIFNVKPHG-KRLVYLDNAATTQKPESVIKAMEEYYEKMNANVYRSPHYLSVLSTEAYEKARDKVKKFVNAKS 83  Caldanaerobacte...
WP_000010075   6 ERIRTDFPILGTKMNG-KALVFLDSAASSQKPFTVIDTIEKYYREENANIHRGIYYLSQKATEKYELSRIRLSKFIGAQC 84  Leptospira inte...
WP_010966565   3 nkyiKDFPTLDQEFNG-HKFVYLDNAATTQKPLSVINAVNDYYRKSNANPHRGAYALSVKATDLYEGARDVVKDFINANK 81  Clostridium ace...
Q9XAD5        11 EAIRKDFPILDRQVHDgHKLVYLDNAATSQKPRQVLDALSEYYERYNANVHRGVHVLAEEATALYEGARDKVAEFINAPS 90  Streptomyces co...
1T3I_A        90 PREIVYTRNATEAINLVAYSWGMN-NLKA----GDEIITTVMEHHSNLVPWQMVAAKTGAVLKFVQLD-EQESFDLEHFK 163 Synechocystis sp.
Q9Z7L5        82 DSEIVFTRGTTAGLNLLAISVNDL-WIPK----GGVVLVSEAEHHANVLSWEIACRRRGSLVKKIRVH-DSGLIDLDDLE 155 Chlamydia pneum...
O84693        79 DQEIIFTRGTTSSLNLLAIAANDS-WLA-----GGTVVISEAEHHANLVSWELACQRSGATIKKVRVD-DEGMVDCSHLE 151 Chlamydia trach...
Q9X191        82 PEEIIFTSGTTMAINLAVVSLLRSgILKE----DDLVLVSLLEHHANFVPWLRLSKFHGYRIDFIRPSgRFGTLEMDDLL 157 Thermotoga mari...
O53155        91 D-ELVFTKNATEALNLVSYVLGDS-RFERavgpGDVIVTTELEHHANLIPWQELARRTGATLRWYGVT-DDGRIDLDSL- 166 Mycobacterium t...
O32164        83 MAEIIFTKGTTTSLNMVALSYARA-NLKP----GDEVVITYMEHHANIIPWQQAVKATGATLKYIPLQ-EDGTISLEDVR 156 Bacillus subtil...
WP_011026662  84 EESIIFTRNTTESINFIAYTWGMK-HIKE----GDEIVLTIAEHHSNILPWQMVAEAKGAKLKYVYLD-ENFRLSMKDFE 157 Caldanaerobacte...
WP_000010075  85 AKVCIFTRNATESINLVAQTWGRT-QIKE----GDEIVLNELEHHSNIVPWQMLAQEKKAVLKFIPLN-EDSTLDFSNLQ 158 Leptospira inte...
WP_010966565  82 SKEIVFVRNATEALNLVAYSYGLN-FINA----GDEIVISIAEHHSNLVPWQQVAKAKGAVLKYLYLN-EDGIIPHEEFE 155 Clostridium ace...
Q9XAD5        91 RDEVIFTKNASESLNLVANMLGWA-DDPYrvdhETEIVITEMEHHSNIVPWQLLAQRTGAKLRWFGLT-DDGRLDLSNID 168 Streptomyces co...
1T3I_A       164 TLLSEKTKLVTVVHISNTLGCVNPAEEIAQLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHKMCAPTGIGFLYG 243 Synechocystis sp.
Q9Z7L5       156 KLLNEGAQFVSIPHVSNVTGCVQPLQQVAELVHRYDAYLAVDGAQGAPHLPIDVQLWDVDFYVFSSHKIYGPTGIGVLYG 235 Chlamydia pneum...
O84693       152 QLLKQGVQLVSLAHVSNVSGAVLPLPEIAHLVHRYEALFAVDGAQGVGKGPLNLSEWGVDFYAFSGHKLYAPTGIGVLYG 231 Chlamydia trach...
Q9X191       158 KHRDKNPKVVAITGLSNVTGQRIPVEELRNVFPN--SIILLDGAQLIPHEPVKPKEIGVDFLAFSLHKMLGPTGVGVLYG 235 Thermotoga mari...
O53155       167 -YLDDRVKVVAFTHHSNVTGVLTPVSELVSRAHQSGALTVLDACQSVPHQPVDLHELGVDFAAFSGHKMLGPNGIGVLYG 245 Mycobacterium t...
O32164       157 ETVTSNTKIVAVSHVSNVLGTVNPIKEMAKIAHDNGAVIVVDGAQSTPHMKIDVQDLDCDFFALSSHKMCGPTGVGVLYG 236 Bacillus subtil...
WP_011026662 158 EKMSDRVKLVAVQHMSNVLGIINPVEEITQIAHKYGAKVLVDGAQSVPHMKVDLKKINCDFFAFSGHKMLGPMGIGVLYI 237 Caldanaerobacte...
WP_000010075 159 EIITTKTKLVAISQMSNVTGTIHDILPVQKRAKEVGAKLLVDGAQGVCHLPVNMKEMEYDFYVFSAHKMLGPTGVGVLYA 238 Leptospira inte...
WP_010966565 156 SKITSKTKIVSVTHVSNVLGTINPVNDIIKKAHSVGAIAILDAAQSIPHMEVDVKALDADFVVFSGHKMLAPMGIGVLYG 235 Clostridium ace...
Q9XAD5       169 EVITEKTKVVSFVLVSNILGTQNPVEAIVRRAQEVGALVCIDASQAAPHMPLDVQALQADFVAFTGHKMCGPTGIGVLWG 248 Streptomyces co...
1T3I_A       244 KEEILEAMPPFFGGGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTDLGMENIHNYEVELTHYLWQGLGQ 323 Synechocystis sp.
Q9Z7L5       236 KKDLLDQLPPVEGGGDMVAIYDHQNPEYLPAPMKFEAGTPNIAGVLGLGAALDYLDGLSAKFIYDKEIALTTYLHKELLE 315 Chlamydia pneum...
O84693       232 KKELLESLPPVEGGGDMVIVYDFEELSYQEPPLRFEAGTPHIAGVLGLGAAIDYLQALPFS-ITDRLTELTHFLYEQLLT 310 Chlamydia trach...
Q9X191       236 KREVLEQMEPFLYGGEMIDRVSLEDVTFNELPYKFEAGTPNIADIVASREALRYLKETGFDSVHEKIEQLTQMALKEMMK 315 Thermotoga mari...
O53155       246 RRELLAQMPPFLTGGSMIETVTMEGATYAPAPQRFEAGTPMTSQVVGLAAAARYLGAIGMAAVEAHERELVAAAIEGLSG 325 Mycobacterium t...
O32164       237 KKALLENMEPAEFGGEMIDFVGLYESTWKELPWKFEAGTPIIAGAIGLGAAIDFLEEIGLDEISRHEHKLAAYALERFRQ 316 Bacillus subtil...
WP_011026662 238 KEDLLDEVPPFLRGGEMIDEVYEEYSTFAPPPLKFEAGTPNVEGAYVLISAIDYLERIGLENIYEHEAKLLEYGLEKINA 317 Caldanaerobacte...
WP_000010075 239 KEEILEEMPPWMGGGDMIAQVYKEKSTYAELPSKLEAGTPNIAGVIGFGSAIEYLENIGMQEIRNHEIELLSYALNRLDD 318 Leptospira inte...
WP_010966565 236 KEALLEKMPPFMFGGDMIEYVWEQKTTFAEVPHKFEGGTQNVGGAVGLTAAIEYLNKVGLDKVYAIEKELTAYALERLSE 315 Clostridium ace...
Q9XAD5       249 RQELLEDLPPFLGGGEMIETVSMHSSTYAPAPHKFEAGTPPVAQAVGLGAAIDYLNSIGMDKILAHEHALTEYAVKRLLE 328 Streptomyces co...
1T3I_A       324 IPQLRLYGPNPKHgDRAALASFNVAGLHASDVATMVDQD-GIAIRSGHHCTQPLHRLFD-------ASGSARASLYFYNT 395 Synechocystis sp.
Q9Z7L5       316 IPGVEILGPSIEE-PRGALIGMTIDGAHPLDLGFLLDLR-GIAVRTGHQCAQPAMERWN-------VGHVLRVSLGIYND 386 Chlamydia pneum...
O84693       311 VPGIQIIGPKQGA-ARGSLCSISIPGVQASDLGFLLDGR-GISVRSGHQCSQPAMVRWD-------LGHVLRASLGIYNE 381 Chlamydia trach...
Q9X191       316 IGGVEIYGPLDE--RQHGIVSFNVKGIHPHDVAHILDQEfGIAVRSGHHCAQPLMSILKeqsqidfPNSTCRASFYIYNT 393 Thermotoga mari...
O53155       326 IDGVRILGPTSMR-DRGSPVAFVVEGVHAHDVGQVLDDG-GVAVRVGHHCALPLHRRFG-------LAATARASFAVYNT 396 Mycobacterium t...
O32164       317 LDGVTVYGPE----ERAGLVTFNLDDVHPHDVATVLDAE-GIAVRAGHHCAQPLMKWLD-------VTATARASFYLYNT 384 Bacillus subtil...
WP_011026662 318 LEYVKTYGPMDSK-DRGGIISFNVEGVHPHDVATILDEE-GIAVRSGHHCCQPLMRYLG-------VPATVRASFYLYND 388 Caldanaerobacte...
WP_000010075 319 FGGLELYGTRDLS-KRGGVISFNFPGVHPHDVGTILDEE-GIAIRVGHHCAQPFMAFQN-------IPGTCRASLYLYNT 389 Leptospira inte...
WP_010966565 316 LPYVKVYGTKDAS-KKAGVISFNVDDVHPHDVATILDSY-GVAIRTGHHCANPLMRYMD-------VNATCRASFYFYNT 386 Clostridium ace...
Q9XAD5       329 VPDLRIIGPTTAE-ERGAAISFTLGDIHPHDVGQVLDEQ-GIAVRVGHHCARPVCLRYG-------IPATTRASFYLYST 399 Streptomyces co...
1T3I_A       396 KEEIDLFLQSLQATIRFFS 414 Synechocystis sp.
Q9Z7L5       387 EDDIDQFILVLQDSLDKIR 405 Chlamydia pneumoniae
O84693       382 QQDILLFVEALKDILRAYR 400 Chlamydia trachomatis D/UW-3/CX
Q9X191       394 EEDVKILVEGVKKVKEWFS 412 Thermotoga maritima MSB8
O53155       397 ADEVDRLVAGVRRSRHFFG 415 Mycobacterium tuberculosis
O32164       385 EEEIDKLVEALQKTKEYFT 403 Bacillus subtilis subsp. subtilis str. 168
WP_011026662 389 FDDIDALVEALKKVRKWFK 407 Caldanaerobacter subterraneus
WP_000010075 390 KDDIDRLIQGLIKVKEIFS 408 Leptospira interrogans
WP_010966565 387 REDVDALVEGLKNTRKWLG 405 Clostridium acetobutylicum
Q9XAD5       400 PAEIDALVDGLEHVRNFFG 418 Streptomyces coelicolor A3(2)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap