Conserved Protein Domain Family
am_tr_V_EF2568

?
TIGR01977: am_tr_V_EF2568 
cysteine desulfurase family protein
This model describes a subfamily of probable pyridoxal phosphate-dependent enzymes in the aminotransferase class V family. Related families contain members active as cysteine desulfurases, selenocysteine lyases, or both. The members of this family form a distinct clade and all are shorter at the N-terminus. The function of this subfamily is unknown. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 131032
View PSSM: TIGR01977
Aligned: 7 rows
Threshold Bit Score: 567.004
Threshold Setting Gi: 499325903
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003469689   4 IYFDNAATTFPKPDSVIKAMFDYMSFEGGSANRGSSSTALQSSRAVYECRYEIAKFFNFPKSENVIFTNNITTSLNMLLL 83  Clostridium per...
WP_010900180   2 IYLDQAASSFPKPKEVAEAMVAAVNEYGANPGRGGHRLATQARVTIDETRELLKTLFNAPSKKHVWFYQNATGALNQALF 81  Bacillus halodu...
WP_009610963   2 IYFDNAATTWPKPEEVYLEVDRMLRNCG-NPGRGGHRMALEASRVIFEARQEIASLFNIKDPMRVVFTLNTTEALNIALK 80  Caldanaerobacte...
WP_010965651   2 IYLDNAATTFPKPDEVYNEVLDCMKNYAANPGRGSYDMAIKASHKVTETREIIAKLFNISDLFNVIFTCSATEALNIGIK 81  Clostridium ace...
WP_002356599   5 VYLNYAATSYKKFPATIEALTAYLAENQ-FMNYGRNAPLLREGLPLLETRQLLADFFQAPSAAQITFTNNATTSLNLALA 83  Enterococcus fa...
WP_005875394   5 TYFDNATSSYPKPDAMRQALAYFYDVPVGSYGRSRDRETLRVTSEVEELRDALADLIGVSESAHICFADNATTGINTILR 84  Porphyromonas g...
WP_011016395   2 NYFDNAATTYPKPKEVYEFMNDFYKNYGGSYARGNYGLENSTTRIVSDTRAKLKKLLKAENK-SVVFTPTATIALNIIIQ 80  Fusobacterium n...
WP_003469689  84 G-IIK---SDWHIITTSMEHNSVLRPLVKISEELpNVELDIVQCNNEGLVSVEKIKEKL-KSNTKLIILSHASNLVGTIQ 158 Clostridium per...
WP_010900180  82 GfPFK---EGDHVVSTALEHNSVRRPLEQLRERN-GLVITYAQPDEEGIISPEKIAQAC-TDQTKAIVLSHGSNVTGAYL 156 Bacillus halodu...
WP_009610963  81 G-VLK---EGDHVITSSMEHNSVARPLSRLKEQ--GVEVTIVKGSEEGKIDPEDIKRAV-KKNTKMIAITHASNVTGTIM 153 Caldanaerobacte...
WP_010965651  82 G-LLK---RKNHVITTCMEHNSVLRPISHLKKK--GVECSIVRADQYGFISPKEIEKLI-RSDTKLIVVNHVSNVTGTIQ 154 Clostridium ace...
WP_002356599  84 G-ILQ---PGDHVITTMLEHHAVARPLHLLEKER-GISVTYVACQKTGLLEVEDIQRAW-RTNTKALVMTHASNVLGTIL 157 Enterococcus fa...
WP_005875394  85 G-SLQ---AGCSVLVSPMEHNAVMRPLQCLADTI-GLKIALMPSMPDGRVDTDRLVSAI-PTDTALAVVNLESNVNGLVQ 158 Porphyromonas g...
WP_011016395  81 G-LIKknrEKKNIYISPFEHNAVVRILEYYKNQG-EIELNILKVENDYTYNLERLKYQFdKKKPDILIISHASNVTGIIL 158 Fusobacterium n...
WP_003469689 159 PIKEIG-KLCKENNIFFILDSAQTAGVIPIDMTELNLNALAFTGHKALLGPQGIGGFIIDDKL--NsiCKNIFSGGTGSN 235 Clostridium per...
WP_010900180 157 ELEKIG-EMAEAHGIVFIVDASQTAGVIDIDMKRDRISMLACAGHKGLLGPQGTGVLIVADDY--G--LTPLSYGGTGSY 231 Bacillus halodu...
WP_009610963 154 PIEEIG-NIAREMNLIFLVDAAQTAGVLPIDVEKYNISLLAFPGHKGLYGPQGTGGLYVKEGI--E--LVPLKEGGTGSR 228 Caldanaerobacte...
WP_010965651 155 NIDEIG-EIAHKNGVCFMVDAAQSAGVLNIDVEKSHIDMLAFPGHKGLMGPQGTGGLFIREGI--K--LTEFKSGGTGSN 229 Clostridium ace...
WP_002356599 158 PIEECF-QWAQQKGLLTILDAAQTAGFLPIKMTQMAIDVLAFTGHKSLYGLAGIGGLAFSERGaeA--VKPLMAGGTGSH 234 Enterococcus fa...
WP_005875394 159 PIEEIArLLTQERGIPILADATQYLGTSRLKADELGLAYVAFTGHKGLLGPSGTGGFYIRDPR--S--VHPLTTGGNGLH 234 Porphyromonas g...
WP_011016395 159 PVEEIA-ILAKEYSSFTVLDMSQTAGLIEINLNLEAIDFAVFAGHKTLYAPTGISGFLTKENI--K--LETILFGGTGYD 233 Fusobacterium n...
WP_003469689 236 SSLIEHPQELPDKFEYGTLNTPGIIGLLEGIKFIEKEGIENIKAKEEVLCQKAMDLLSeIPEVKIYGPMDAKKKTSTISF 315 Clostridium per...
WP_010900180 232 SELIDQPSQWPDRYESGTLNTPGIAGLKAGIEYVLDNGVAQIFAHEWALTERLLKGLG-AQKVDVYGPPLPRKRLGVVSF 310 Bacillus halodu...
WP_009610963 229 SELTLQPDLMPDKLESGTLNTPGIAGLKEGVKFVKKVGVNSIREREVKLTELLIEGLReIKKVRVYGPQKIEDRVGVVSI 308 Caldanaerobacte...
WP_010965651 230 SFSVDQPEFLPDRFESGTLNTPGISGLNAGIKFINSIGLKNIEKHEMELTEYLIRNLKnKDYVKIYG-HELQNRGAVVSF 308 Clostridium ace...
WP_002356599 235 SNSFDQPSFLPDKFEAGTLNSLGILSLNSSIKELNKIGLAAIQKHERTLMQNFLNGLS-GLPVTILGTKDVAQTVPVVSI 313 Enterococcus fa...
WP_005875394 235 SADWTVGVEMPERFMAGTVNVLGLTALLASVRQLPPFRISRDAWKQCMQQMQRFPGLR------VYGAADPIEQGYLCSL 308 Porphyromonas g...
WP_011016395 234 SANLEMPSSVPERYEMGTLNIQAIAGLNAALKWIEEIKIINLYKKELHNRNKLKNILKkYNFIKIVGDNDEANYVGIISF 313 Fusobacterium n...
WP_003469689 316 NIEGMDPEFTGFLLDSEFNITCRTGIHCTPLAHKTVGSYPAGSIRISLGYFNTIEEVYRFVEVIKEL 382 Clostridium perfringens
WP_010900180 311 RLSGFDSHEVALILDEHYQIAVRAGLHCAPMTHETLQTTDTGLIRVSVGPFNTEREVDQLLQAVMDI 377 Bacillus halodurans
WP_009610963 309 TVEGMDVGEVSHILDREFDIATRAGLHCAPLAHSTIGTLKSGTLRFGIGYFNTEEEIIKAVEAIETI 375 Caldanaerobacter subterraneus
WP_010965651 309 NIDGIDSSDVAAILNVK-GICVRNGYHCAPLVHEIIGTKNRGTVRVSPGYFNTIEDIDKLIEAVVEI 374 Clostridium acetobutylicum
WP_002356599 314 TLWNQEETIVAQQLAEQYGIMTRAGLHCAPLAHQTAGTLATGTLRFSFGWQTTPEEITWTIHALQEL 380 Enterococcus faecalis
WP_005875394 309 THDRLTPARIGDALYEAFDIVTRTGIHCAPLAHRSIGTFATGTVRLSLSPYHEEADLEYLLNALSHV 375 Porphyromonas gingivalis
WP_011016395 314 IVENISSESLAPVFSHK-NIIVRTGLHCAPLAHKFLGTFPAGTIRLSTSYFTNDEDFENLTRLLDYI 379 Fusobacterium nucleatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap