Conserved Protein Domain Family

TIGR01968: minD_bact 
septum site-determining protein MinD
This model describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model. [Cellular processes, Cell division]
PSSM-Id: 131023
Aligned: 9 rows
Threshold Bit Score: 407.109
Threshold Setting Gi: 3024144
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q01464       226 -NRASIAYRNIARRILGESVPLQV-LEEQNKGMMAKIKSFF 264 Bacillus subtilis subsp. subtilis str. 168
Q55900       224 lSVPGLAFQNIARRLEGQDIPFLD-FMAAHNTLLNRIRRRL 263 Synechocystis sp. PCC 6803 substr. Kazusa
WP_010964562 224 -ANAGKAFRDIARRVLGEEVPFEK-YETQT-GFIAAIKKIF 261 Clostridium acetobutylicum
WP_010887398 234 -TKAGDAFMATAQRIQGQDVPFPK-LTEEEKGIWAAIRRLF 272 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap