Conserved Protein Domain Family
minD_bact

?
TIGR01968: minD_bact 
septum site-determining protein MinD
This model describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 131023
View PSSM: TIGR01968
Aligned: 9 rows
Threshold Bit Score: 407.109
Threshold Setting Gi: 3024144
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9X2I3         2 GNVIVVTSGKGGVGKTTITANLGCALAKLGEKVCLIDADIGLKNLDIVLGLENRIVYTMIDVVNGKVSPQEALVKHKMLK 81  Thermotoga mari...
Q01464         2 GEAIVITSGKGGVGKTTTSANLGTALAILGKRVCLVDTDIGLRNLDVVMGLENRIIYDLVDVVEGRCKMHQALVKDKRFD 81  Bacillus subtil...
Q9ZMA8         2 AIVVTITSGKGGVGKSTTTANLAIGLAESGKKVVAVDFDIGLRNLDMILGLENRIVYDVVDVMEKNCNLSQALITDKKTK 81  Helicobacter py...
P56346        16 ERVIVITSGKGGVGKTTTTANLGMSIARLGYRVALIDADIGLRNLDLLLGLENRVLYTAMDIVEGQCRLDQALIRDKRWK 95  Chlorella vulgaris
O78436         2 ARIVVITSGKGGVGKTTVTANLGMALAQLGYRTALIDADIGLRNLDLLLGLENRVIYTALEVLSGECRLEQALIKDKRQP 81  Guillardia theta
Q55900         2 NRIIVVTSGKGGVGKTTTTANLGAALARLGKKVVLIDADFGLRNLDLLLGLEQRIVYTAIDVLADECTIDKALVKDKRLP 81  Synechocystis s...
WP_010964562   2 GEAIVITSGKGGVGKTTTTANIGTALAAMKKKVVLVDGDTGLRNLDVLMGLENRIVFTLLDVVEGNCRLKQALIKDKHYE 81  Clostridium ace...
WP_010887398  11 AKVIVVTSGKGGVGKTTTTANIGAALARLGEKVVVIDVDVGLRNLDVVMGLESRVVFDLVDVLEGKCRMNQALIRDKRVE 90  Deinococcus rad...
WP_003252574   2 AKILVVTSGKGGVGKTTTSAAIGTGLALRGHKTVIVDFDVGLRNLDLIMGCERRVVYDFVNVVNGEANLQQALIKDKRLE 81  Pseudomonas
Q9X2I3        82 -NLYLLPASQIATKEMISPNDMKAIVKELIPh--FDYIIIDSPAGIERGFRNAVAPAERVLVVTTPELPAISDADRVIGL 158 Thermotoga mari...
Q01464        82 dLLYLMPAAQTSDKTAVAPEQIKNMVQELKQe--FDYVIIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGL 159 Bacillus subtil...
Q9ZMA8        82 -NLSFLAASQSKDKNILDKEKVAILINALRAd--FDYILIDSPAGIESGFEHAILHADMALVVVTPEVSSLRDSDRVIGI 158 Helicobacter py...
P56346        96 -NLALLAISKNRQKYNVTRKNMQNLIDSVKEl-gFQFVLIDCPAGIDVGFINAIASAQEAVIVTTPEITAIRDADRVAGL 173 Chlorella vulgaris
O78436        82 -NLVLLPAAQNRNKDSVTEEQMKFLVN-LLVn-dYDYLLIDCPAGIETGFHNAIGPAQEAIVVTTPEIAAVRDADRVIGL 158 Guillardia theta
Q55900        82 -NLVLLPAAQNRSKDAINAEQMQSLVEQLKDk--FDYIIIDCPAGIEAGFRNAVAPAQEAIIVTTPEMSAVRDADRVIGL 158 Synechocystis s...
WP_010964562  82 -NLALLPTAQTRDKNDVKPEQMLKLVNELKEe--FDYVIIDCPAGIEQGFENAVIGADRAIVVVNPEVTSVRDADRVIGK 158 Clostridium ace...
WP_010887398  91 -NLHLLPASQTRDKDALDPEVFKEVVKGLLEeegFDRVLIDSPAGIESGFRTAAAPAEGALVVVNPEVSSVRDADRIIGL 169 Deinococcus rad...
WP_003252574  82 -NLYVLAASQTRDKDALTQEGVEKVLMDLKKd--FEYVICDSPAGIEKGAHLAMYFADEAIVVTNPEVSSVRDSDRMLGI 158 Pseudomonas
Q9X2I3       159 LENFGfSD--------Ek-----INVIINRFKPHMVKKGEMLTTDDIKHTLSLEIIAVIPDSEDIIVASNTGIPVSLNGN 225 Thermotoga mari...
Q01464       160 LEQEEnIE--------P------PRLVVNRIRNHLMKNGDTMDIDEIVQHLSIDLLGIVADDDEVIKASNHGEPIAMDPK 225 Bacillus subtil...
Q9ZMA8       159 IDAKSnRA--------KsgeevhKHLIINRLKPELVANGEMISIEEVLKILCLPLIGIIPEDHHIISATNKGEPVIRTD- 229 Helicobacter py...
P56346       174 LEANG-IY--------N------VKLLVNRVRPDMIQKNDMMSVRDVQEMLGIPLLGAIPEDTSVIISTNKGEPLVLNKK 238 Chlorella vulgaris
O78436       159 LEANG-IK--------Q------IKLLVNRLRPQMVKANDMMSVADVREILAIPLIGVIPEDECVIVSTNRGEPLVLEKN 223 Guillardia theta
Q55900       159 LEAED-IG--------K------ISLIVNRLRPEMVQLNQMISVEDILDLLAVPLIGILPDDQKIIISTNKGEPLVMEEK 223 Synechocystis s...
WP_010964562 159 IDAKG-IE--------D------HQVIVNRIDYEMVKRGDMLGIEDVIDNLAIKLIGVVPNDKQITVSTNKGEPIVLNQN 223 Clostridium ace...
WP_010887398 170 LEAQQ-IT--------E------IRLVVNRLRPKMVASGNMLSIDDMVDILGVKPIGIVPEDEGIIVSTNVGEPAVL-GK 233 Deinococcus rad...
WP_003252574 159 LSSKS-RRsengeepiK------EHLLITRYHPERVVKGEMLSVADVEEILSIKLKGVIPESQAVLKASNQGIPVILDDQ 231 Pseudomonas
Q9X2I3       226 -SRISKNFENLARRIRGEGVPLENdFVTVSKGLIDTLKDFF 265 Thermotoga maritima MSB8
Q01464       226 -NRASIAYRNIARRILGESVPLQV-LEEQNKGMMAKIKSFF 264 Bacillus subtilis subsp. subtilis str. 168
Q9ZMA8       230 -CESAKAYQRITRRILGEEVEYVE-FK-AKRGFFSALKGIF 267 Helicobacter pylori J99
P56346       239 lTLSGIAFENAARRLIGKQDYFID-LTSPQKGMFQKLQEFF 278 Chlorella vulgaris
O78436       224 lSLPGLAFEHTACRLDGQEIEFLD-LQSYSRGPLKRLRRFF 263 Guillardia theta
Q55900       224 lSVPGLAFQNIARRLEGQDIPFLD-FMAAHNTLLNRIRRRL 263 Synechocystis sp. PCC 6803 substr. Kazusa
WP_010964562 224 -ANAGKAFRDIARRVLGEEVPFEK-YETQT-GFIAAIKKIF 261 Clostridium acetobutylicum
WP_010887398 234 -TKAGDAFMATAQRIQGQDVPFPK-LTEEEKGIWAAIRRLF 272 Deinococcus radiodurans
WP_003252574 232 -SDAGQAYSDAVDRLLGKEKPMRF-IDVQKKGFFERIFGSK 270 Pseudomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap