1UDN


Conserved Protein Domain Family
RNasePH

?
TIGR01966: RNasePH 
Click on image for an interactive view with Cn3D
ribonuclease PH
This bacterial enzyme, ribonuclease PH, performs the final 3'-trimming and modification of tRNA precursors. This model is restricted absolutely to bacteria. Related families outside the model include proteins described as probable exosome complex exonucleases (rRNA processing) and polyribonucleotide nucleotidyltransferases (mRNA degradation). The most divergent member within the family is RNase PH from Deinococcus radiodurans. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 131021
View PSSM: TIGR01966
Aligned: 11 rows
Threshold Bit Score: 401.356
Threshold Setting Gi: 21759403
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UDN_A   2 RSDGRKEDQLRPVSIQRDFLEYPEGSCLISFGKTKVICTASVIENVPNWLKGKGQGWITAEYSMLPRATQQRTIRESVQG 81  Aquifex aeolicus VF5
Q8XI67   2 RSSGRKKEQIRPVKITRNFTKYAEGSVLIEVGDTKVLCTASIEEKVPPFLKGSGEGWITAEYNMLPRSTQSRKQRDINKL 81  Clostridium perfringe...
Q8NMR4   9 RFDGRAQDQMRAVKITRGFTSNPAGSVLVEFGNTRVMCTASVELGVPRFKRDSGEGWLTAEYAMLPAATAERNRRESMAG 88  Corynebacterium gluta...
Q8XXF5   2 RPSGRQPDQLRPVTLTRHYTRHAEGSVLVCFGDTHVLCTASVLPKVPPHKKGSGEGWVTAEYGMLPRSTHTRSDREAARG 81  Ralstonia solanacearu...
Q8Y7N6   2 RVDGRESNALRNIEVTPDYLMHPEGSVLIASGNTKVICSASVETKVPPFMRGEGRGWISAEYSMLPRATNTRNIRESSKG 81  Listeria monocytogene...
O67069   2 RSDGRKEDQLRPVSIQRDFLEYPEGSCLISFGKTKVICTASVIENVPNWLKGKGQGWITAEYSMLPRATQQRTIRESVQG 81  Aquifex aeolicus VF5
Q92SK2   2 RPSGRKTDQMRKVSFERSFSKHAEGSCLVRFGDTHVLCTASLEEKVPAWLRNGGKGWITAEYGMLPRATGERMRREAATG 81  Sinorhizobium melilot...
Q9ZCT5   2 RQSGRKSNQLRPISLELSPLINAEGSCLIKIGNTHVMCSATCETTVPPFLRGQNQGWITAEYGMIPGSTSHRIKREAALG 81  Rickettsia prowazekii...
Q9JTN2   6 RIS-RAADSLRDIKITPHFLPHTDGSCLIECGNTKVICTASIDENVPPFLRGKNQGWVTAEYGMLPASTASRMRREASAG 84  Neisseria meningitidi...
Q8Z0M2   5 RPDGRKPYELRPINFHTKFTRFAPGSVLTICGETKVLCTVSVAESVPKFLTGSGKGWLTAEYRMLPSATQQRHERE--LL 82  Nostoc sp. PCC 7120
Q9S2H7   3 RIDGRTPQQLRPVTIERGWSKHAEGSVLVSFGDTKVLCNASVTEGVPRWRKGSGEGWVTAEYAMLPRATNTRGDRESVKG 82  Streptomyces coelicol...
1UDN_A  82 RIGGRTHEIQRMIGRAMRTAVELTKIGERTIWVDCDVIQADGGTRTAAITGAFVAVADAIIKLHKEGIIEE--TPIKD-F 158 Aquifex aeolicus VF5
Q8XI67  82 KIDGRTMEIQRLIGRALRSAVDMKALGEKTIWIDCDVLQADGGTRTTSITGSFVALVDAVNKLHQKKPFNV--YPIRH-F 158 Clostridium perfringe...
Q8NMR4  89 KVKGRTHEISRLIGRSLRAAVDLSQLGENTIAIDCDVLQADGGTRTASITGAYVALADAIKVLQERGVVPGs--PLLA-P 165 Corynebacterium gluta...
Q8XXF5  82 KQSGRTQEIQRLIGRAMRSVFDLSALGEHTIHLDCDVLQADGGTRTASITGAFVAAHDAISVMRKKGQLTG--EPIRD-F 158 Ralstonia solanacearu...
Q8Y7N6  82 KVTGRTMEIQRLIGRALRAVVDLDALGERTIWLDCDVIQADGGTRTASITGAFIAMVMAIAKLDEAVPFAK--FPVKD-F 158 Listeria monocytogene...
O67069  82 RIGGRTHEIQRMIGRAMRTAVELTKIGERTIWVDCDVIQADGGTRTAAITGAFVAVADAIIKLHKEGIIEE--TPIKD-F 158 Aquifex aeolicus VF5
Q92SK2  82 KQSGRTQEIQRLIGRSLRAVVDLPALGERQISIDCDVIQADGGTRTASITGAWIALHDCLKWMEARNMVKL--EKVLKdH 159 Sinorhizobium melilot...
Q9ZCT5  82 KQGGRTQEIQRLIGRAMRCVINLQKLGERQIIIDCDVINADGGTRTAAITGSYVALHLAIRSLMKKRILKV--NPLIS-Q 158 Rickettsia prowazekii...
Q9JTN2  85 KQSGRTQEIQRLIGRSLRAVVDMEKLGERQILIDCDVIQADGGTRTASITGAFVALQIAVGKLVSDGILSE--NPIRE-A 161 Neisseria meningitidi...
Q8Z0M2  83 KLSGRTQEIQRLIGRSLRAALDFEALGERTLTVDADVLQADAGTRTAAITGGFVALAEAISQLLQRGVLER--SPLCG-Q 159 Nostoc sp. PCC 7120
Q9S2H7  83 RIGGRTHEISRLIGRSLRAVIDYKALGENTVVLDCDVLQADGGTRTAAITGAYVALADAVAWAQGRKLIKAnrKPLTG-T 161 Streptomyces coelicol...
1UDN_A 159 VAAVSVGIVNDR-ILLDLNFEEDSAAQVDMNVVGTGSGRLSEVHTMGEEYSFTKDELIKMLDLAQKGINELIELQKKLYV 237 Aquifex aeolicus VF5
Q8XI67 159 VSAVSVGIVGEE-KILDLCYEEDHVAKVDMNVVMTEEGEFIEIQGTGEAGPFSRKELDELLNLAEKGAKQMIQAQKDALK 237 Clostridium perfringe...
Q8NMR4 166 VAAVSVGLVDGN-VCLDLPYEEDSRADVDLNVVMTEHGEFVEIQGTGEETTFTRAQLNDMLDHAEKGCRELVAAQKAALG 244 Corynebacterium gluta...
Q8XXF5 159 VAAVSVGVVDGV-PVLDLDYPEDASCDTDMNIVMTGAGGFVEVQGTAEGTPFTRTEMDALLGLADHGIRTLIGLQKQALG 237 Ralstonia solanacearu...
Q8Y7N6 159 LAATSVGVLEEGgTVLDLNYVEDSAAQVDMNIIMTGSGAFVELQGTGEEATFSETELAELIALGKKGISELIEIQKETLG 238 Listeria monocytogene...
O67069 159 VAAVSVGIVNDR-ILLDLNFEEDSAAQVDMNVVGTGSGRLSEVHTMGEEYSFTKDELIKMLDLAQKGINELIELQKKLYV 237 Aquifex aeolicus VF5
Q92SK2 160 VAAISCGIFANQ-PVIDLDYLEDSAAETDANFVMTGSGGLVEIQGTAEGKPFSEEEFASLMLLAKNGIAELVEMQKQAIA 238 Sinorhizobium melilot...
Q9ZCT5 159 IAAISCGIYKGN-AVLDLDYLEDSDAEVDSNFVFACNGNLIEVQGTAEKEPFSEEQFLAMLKLAKSGVVELFKLQNQVLI 237 Rickettsia prowazekii...
Q9JTN2 162 VAAVSVGVVNGV-PLLDLDYPEDSGCDSDVNIVMTASGKIIEIQGTAEDAPFSLDELGKLVALAQKGIGELLQHQQNALS 240 Neisseria meningitidi...
Q8Z0M2 160 IAAVSVGLLEQE-AYLDLNYIEDVAATVDFNVVMNKNLGIIEVQGTAEEGSFSRTQLNQLLDCAETGIQQLLIAQQQAIT 238 Nostoc sp. PCC 7120
Q9S2H7 162 VSAVSVGIVDGT-PLLDLRYEEDVRADTDMNVVCTGDGRFVEVQGTAEAEPFARDELNTLLDLATAGCTELAELQRKALD 240 Streptomyces coelicol...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap