Conserved Protein Domain Family
ndhF3_CO2

?
TIGR01960: ndhF3_CO2 
NAD(P)H dehydrogenase, subunit NdhF3 family
This family represents a subfamily of NAD(P)H dehydrogenase subunit 5, or ndhF. It is restricted to two paralogs in each completed cyanobacterial genome, in which several subtypes of ndhF are found. Included in this family is NdhF3, shown to play a role in high-affinity CO2 uptake in Synechococcus sp. PCC7002. In all cases, neighboring genes include a paralog of ndhD but do include other NAD(P)H dehydrogenase subunits. Instead, genes related to C02 uptake tend to be found nearby.
Statistics
?
PSSM-Id: 131015
View PSSM: TIGR01960
Aligned: 6 rows
Threshold Bit Score: 895.242
Threshold Setting Gi: 499176446
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010874033   1 MSDFLLQSSWFIPFYGLIGSILSLPWSFRLIKQTGPRPAAYFNVFMTLVSAIHGMVALSAIWQTPSEQIVFHWLQVADLD 80  Synechocystis s...
WP_010998295   1 MAQFLLETVWLVPLYALIGGLLAIPWSPGIIRKTGPRPAGYVNLIMTFLALVHSAIALQATWSHPPQEVFLPWLSTAGLD 80  Nostoc sp. PCC ...
WP_011057958   1 MPNSLLETSWWVPCYGLVGAALTLPWATGYVRRTGPRPAAYFNLLMTVVAFGHGFFLLQQTRSGATATIVWHWLQAPGLD 80  Thermosynechoco...
WP_010872065   1 MLESLSRIIWLVPCYALLGALLAVPWSPGLTRQTGPRPAGYISTLMTFVAFLHSLLVLIHIWQQPAIDLSFPWLHAADLE 80  Synechocystis s...
WP_010995043   1 MNQFLFATSWCVPFYSLLGALLTLPWGIGIVRRTGPRPAAYFNLLTTIVGFAHSLWVFKDIWSREQENLVITWFQAADLN 80  Nostoc sp. PCC ...
WP_011056748   1 MLQSFADTVWLIPFYSLAGMVLSLIWSPGITRKTGPRPAGYLNILLTFFSFVHALLATVAIANQPPQYLHWTWLDVAGLH 80  Thermosynechoco...
WP_010874033  81 LTLAVEISPVSLGALSVVTGISFLVQIFGLGYMEKDWSLARFYGLLGFFEAALGGIALSDSLFLSYGLLEMLTLSTYLLV 160 Synechocystis s...
WP_010998295  81 LTIAIEISSISVGAMVVITGLNFLAQIFAIGYMEMDWGLGRFYSLLGLFEAGLCALVLCNNLFFSYVILEILTLGTYLLV 160 Nostoc sp. PCC ...
WP_011057958  81 LSFSLLINSVTTGAMELVTGLSILAQIFALGYLEKDWGMARFFALMGFFEAALSGIAISDSLLLSYGLLEMLTLSTYLLI 160 Thermosynechoco...
WP_010872065  81 INFDLKISTVNIAALVLITGLNLGAQIYAIGYLERDWGWARFFSLMALFEAGLCTLVLCNSLFFSYVVLEILTLGTYLLI 160 Synechocystis s...
WP_010995043  81 LSFALELSPVSMGATVLITGLSLLAQIYALGYMEKDWSLARFFGLLGFFEAALSGLAISDSLFLSYGLLEILTLSTYLLV 160 Nostoc sp. PCC ...
WP_011056748  81 LDIPVEISILTTTALMLITALNLMAQVFAVGYMEMDWGWARFFALLALFEGGMGALVLLDSLFFNYVVLEILTLATYLLI 160 Thermosynechoco...
WP_010874033 161 GFWYAQPLVVTAARDAFLTKRVGDIILLMGVVALSSYGQGLTFSQLDNWASTVPVTGITATLLGLSLIAGPTGKCAQFPL 240 Synechocystis s...
WP_010998295 161 GLWFSQPLVVSGARDAFLTKRVGDLFLLMGVLGLWPLAGTWNYPELAQWAQTANVDPTIITLVGLALVAGPMGKCAQFPL 240 Nostoc sp. PCC ...
WP_011057958 161 GFWYAQPLVVKAARDAFLTKRVGDILLLMGVVALGSLAGSYDFPHLYEWAEQANLPDGWGFLLGLALIAGPTGKCAQVPL 240 Thermosynechoco...
WP_010872065 161 GYWFNQSLVVTGARDAFLTKRVGDLILLMGVVALLPLAGSWNYDDLAQWAASADLNPTAATLLCLALIAGPLAKCAQFPL 240 Synechocystis s...
WP_010995043 161 GFWYAQPLVVTAARDAFWTKRVGDLLLLMAVVTLSTLAGSLNFSDLYEWVQTANLDPVTATLLCLGLIAGPAGKCAQFPL 240 Nostoc sp. PCC ...
WP_011056748 161 GLWFNQPLVVTGARDAFLTKRVGDLVLLMGVLAIYPLAGSWNYDDLAAWAATAQVNSTLITLICLALIAGPMGKCAQFPL 240 Thermosynechoco...
WP_010874033 241 NLWLDEAMEGPNPAGIMRNSVVVSAGAYVLIKLQPVFTLSPIASKTLIVLGTLTVVMTSLIAIAQIDIKRTLSHSTSVYL 320 Synechocystis s...
WP_010998295 241 HLWLDEAMEGPMPSTILRNSVVVASGAWVLIKLQPVLTLSPVVSSFIVAIGAVTAIGGSLIAIAQIDVKRCLSYSVSAYM 320 Nostoc sp. PCC ...
WP_011057958 241 HLWLDEAMEGPNPASIMRNSVVVAAGAYILIKLQPILVACPGANIALIAIGTVTAISESLVSIAQIDIKRALSHSTSVYL 320 Thermosynechoco...
WP_010872065 241 HLWLDEAMEGPIPATILRNTLVVATGAWVLVKVQPILALSPVALTVMIAIGSVTAIGASLIAIAQIDIKRFLSYVVSAYM 320 Synechocystis s...
WP_010995043 241 HLWLDEAMEGPNPASVMRNSLVVAGGAYLLYKLQPILILSPVALNVLIIIGGVTAIGASLVSIAQTDIKRALSHSTSAYM 320 Nostoc sp. PCC ...
WP_011056748 241 HLWLDEAMEGPIPASILRNAVVVATGAWVLVKLTPVLSLSPVALTALLVIGSVTALGGTLIAIAQVDIKRALSYLVSAYM 320 Thermosynechoco...
WP_010874033 321 GLVFIAVGLGQVDIAFLLLFAHAIAKALLFMSIGSIIFTTSGQNITEMGGLWNRMPVTTTSFVVGSAGLLAVFPLGMFWT 400 Synechocystis s...
WP_010998295 321 GLVFIAVGARQDEAALLLVLTHAVSAALLVMSTGGIIWNSITQDVTQLGGLWSRRPISGLAFIVGTLGLIGFPPLGGFWA 400 Nostoc sp. PCC ...
WP_011057958 321 GLVFIGVGTNWTDFALFVLLTHAIAKALLFMSIGSVIMTTNSQDLTELGGLGERMPATSSAFVIGGLSLIGCLPLGAFWS 400 Thermosynechoco...
WP_010872065 321 GLVFIAVGTGQGETALQLIFTYTFAMAILVMCVGGIILNNVTQDLTQYGGLWSRRPISGLSYLVGVASLIALPPFGTFWA 400 Synechocystis s...
WP_010995043 321 GLVFLAVGLEQGGVALMLLLTHAIAKALLFMSSGSVIFTTHSQDLTEMGGLWSRMPATTTAFVVGSAGMVTLLPLGSFWA 400 Nostoc sp. PCC ...
WP_011056748 321 GWVFIAVGLKEPGLAFVFILTYSLAMAVLMMSIGSIIWNSVTQDLRLLGGLWSRRPISGISFLVGSAGLLAVPPLASFFP 400 Thermosynechoco...
WP_010874033 401 WQKWFSGDWLVSWPLLALLIFVNLFSALNLTRVFRLVFLGKPQPKTRRAPEVPWPMAVPMVSLIIVTLLVPIAPLQWSFW 480 Synechocystis s...
WP_010998295 401 LLKLADGLWGTHPWLVGIVIAVNALTAFSLVREFGLIFGGKAKQMTERSPEVHWPMVLPMMILFGFVLHLPLILQALSLL 480 Nostoc sp. PCC ...
WP_011057958 401 FYRGISYYWQTMPWLVGLILVVNLLTAVNLTRVFRLVFLGPAQPKTRRAPEVTWPLAVPMVTLSILNMLVPFILQRVQLL 480 Thermosynechoco...
WP_010872065 401 WLKLAENLSATSPLLVGVLLVVNLLTAFNVTRGFCLIFGGEAKPMTVRSPEGLWALVLPMVVTVGFALHLSLILKQGNLL 480 Synechocystis s...
WP_010995043 401 MLSWADGLVRVSPWVIGVLILVNGLTALNLTRVFRLAFWGQPQQKTRRAPEVGWTMAFPMVTLIILTLLLPLMLQQWYLL 480 Nostoc sp. PCC ...
WP_011056748 401 QAELLDTAFAQLPWVGGVLLLMNTFAAFSLGRTFCLVWGGEVKPMTARSPEVFWPMILPMTVDLGLVLHLPILMARFDWV 480 Thermosynechoco...
WP_010874033 481 LsatyplgLTSPVTQWAMPLLMVAGITGILLGSLMPLRRNLSRSSRLPVRFLQDLFAYDVYLDKIYGATVVAAVAAIAKI 560 Synechocystis s...
WP_010998295 481 P-------DWAILNKDVVLLLIWSTIFGCSISSVIYLSNIIPKPIRLPWKGLQDLLAYDFYTPNLYRITIIFSVAQLSKF 553 Nostoc sp. PCC ...
WP_011057958 481 P---------ETIDWTIVALLVVSGLAGILLGGFVTLKRSWTRPIKVPLRFVQDLLAYDFYIEELYRYTVVWAVRSLSQL 551 Thermosynechoco...
WP_010872065 481 P-------DFADINWGLSSVLIASSLLGVGSSAFIYLNPKITKPIDLPLPVVQNFFAYDLYTDKFYKLTIVAVIDSISRL 553 Synechocystis s...
WP_010995043 481 P-------AWESIDWYVVLVLVSSTVAGVVIGSTIHLHKAWSRSTVLAWRFIQDLLGYDFYIDRIYRLTVVSAVALLSRI 553 Nostoc sp. PCC ...
WP_011056748 481 --------IWTQPSLATAAALTITALLGWGVAAWVYLGKAIPKPVQFPLPSVQNLLAYDFYTPKLYRATVVGVVDMISRI 552 Thermosynechoco...
WP_010874033 561 STWFDRYVIDGIVNLVSLVTIFSGSALKYNVTGQSQFYLLTILVGVALLIWFS 613 Synechocystis sp. PCC 6803
WP_010998295 554 ADMIDRFVVDGIVNFVGLFSLLGGEGLKYSTSGQTQFYALTVLLGVGVLGAWV 606 Nostoc sp. PCC 7120
WP_011057958 552 SAWVDRHIVDRIVNTTGAASLVGGELLKYSASGQSQAYLLLVFIGVAILGGAI 604 Thermosynechococcus elongatus
WP_010872065 554 INWFDKTFVDGVINLIGIVTIFSGQSLKYNVSGQTQFYVLSIVLGLTLIGAFL 606 Synechocystis sp. PCC 6803
WP_010995043 554 SAWSDRYLVDGLVNLVGFATIFGGQGLKYSISGQSQGYMLTILAVVGALGFFI 606 Nostoc sp. PCC 7120
WP_011056748 553 TAWFDRTFVDGTGNAFGVVTLLGGDRLKYSTTGQSQAYILTILMGIAILVIAI 605 Thermosynechococcus elongatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap