Conserved Protein Domain Family
nuoF_fam

?
TIGR01959: nuoF_fam 
NADH-quinone oxidoreductase, F subunit
This model describes the F chain of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoF. This family does not have any members in chloroplast or cyanobacteria, where the quinone may be plastoquinone and NADH may be replaced by NADPH, nor in Methanosarcina, where NADH is replaced by F420H2. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131014
View PSSM: TIGR01959
Aligned: 11 rows
Threshold Bit Score: 725.28
Threshold Setting Gi: 500034451
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P31979        12 PLTWRLR--DdK-QPVWLDEYRSKN---GYEGARKALTG-LSPDEIVNQVKDAGLKGRGGAGFSTGLKWSLMPKDES--- 81  Escherichia col...
Q8K9Y3        12 PLTWRLR--NdR-ETVWIEEYCKKN---GYFSLKKALKT-MCPEDVVHLIKESGLKGRGGAGFSTGLKWSLMSKDNS--- 81  Buchnera aphidi...
P95176        11 VISRHWD--D-P-ESWTLATYQRHDryrGYQALQKAL-T-MPPDDVISIVKDSGLRGRGGAGFATGTKWSFIPQGDTgaa 84  Mycobacterium t...
P56912         7 RIFTNIY--G-L-KDKSLRGAMARG---HWDGTKQFLEK--GRDWIINEVKASGLRGRGGAGFPTGLKWSFMPKESd--- 74  Sinorhizobium m...
Q9ZE33         7 KIFTNLY--G-Q-QSYDLKSSQKRG---DWYNTKALIDK--GRDFIIDEVKKSGLRGRGGAGFSTGMKWSFMPKNS---- 73  Rickettsia prow...
P56913         5 VLLRNVD--V-P-DGHLLSTYEAGG---GYRALRKALGE-YTPDEIVELVKESNLRGRGGAGFPTGMKWSFVPKAAg--- 73  Sinorhizobium m...
WP_010954901  20 PLTWRLR--D-DgEPVWLAEYESKN---GYAAARKALAQ-MSADDIVQSVKDSGLKGRGGAGFPTGVKWGLMPKDES--- 89  Pseudomonas putida
WP_014573730   8 VIFDQVDtaN-P-DCWTLDEYVKRG---GYTALRKILSEnISQTDVIDEVKTSGLRGRGGAGFPTGLKWSFMPRSF---- 78  Neisseria menin...
WP_000829484   6 LLTKYID--N-P-QSTKLEFYESVH---GYDGMKKALQ--MKPDDIIAEVKKSGLRGRGGAGFPTGLKWSFIPKDI---- 72  Leptospira inte...
WP_011037654  20 VVYTTLH--Y-D-TPWSYESYLKTG---GYAALRKILEEkIPPGDVIEMVKASNLRGRGGAGFPTGLKWSFMPKG----- 87  Xanthomonas cam...
WP_011715169   7 VLFKNIH--I-Q-GQNTLAVAQQQG---AYKRMEKALG--MSGEEIIQEVKSAGLRGRGGAGFPAGLKWSFIPKDD---- 73  Magnetococcus m...
P31979        82 MNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEA-AVNLRRAIAEATEAGLLGKNI 160 Escherichia col...
Q8K9Y3        82 SKIRYLLCNADEMEPGTYKDRFLMENIPHQLIEGMLLSAFALNVSRGYIFLRGEYIKA-EYILKKSIQEAINFGFIGSNI 160 Buchnera aphidi...
P95176        85 AKPHYLVVNADESEPGTCKDIPLMLATPHVLIEGVIIAAYAIRAHHAFVYVRGEVVPV-LRRLHNAVAEAYAAGFLGRNI 163 Mycobacterium t...
P56912        75 GRPHYLVVNADESEPGTCKDRDIMRHDPHTLIEGCVIASFAMGAHAAYIYVRGEFIRE-REALQAAIDECYEYGLLGKN- 152 Sinorhizobium m...
Q9ZE33        74 EKPCYLVVNADESEPGTCKDRDILRFEPHKLIEGCLIASFAIGANTCYIYIRGEFYNE-ASNMQRALDEAYKEGLIGKNA 152 Rickettsia prow...
P56913        74 -KPKYLCCNADEGEPGTFKDRIIMERDPHQLIEGLAVSAYAIGAETAYVYIRGEYVTA-IRRMEQAIAEAHENGYLGIGI 151 Sinorhizobium m...
WP_010954901  90 MNIRYLLCNADEMEPNTWKDRMLMEQQPHLLVEGMLISARALKAYRGYIFLRGEYTTA-AKNLNRAIDEAKAAGLLGKNI 168 Pseudomonas putida
WP_014573730  79 PGEKYVVCNTDEGEPGTFKDRDIIMFNPHALIEGMIIAGYAMGAKAGYNYIHGEIFEG-YQRFEAALEQARAAGFLGKNI 157 Neisseria menin...
WP_000829484  73 PKPKYIICNADEGEPGTFKDRKLIENLPHQIIEGMIIGARAIGSNKGFFYIRGEFQKG-AKAMQAAIDEAYSKGYLGKNI 151 Leptospira inte...
WP_011037654  88 TMQKYILCNSDESEPGTCKDRDILRYNPHSVVEGMAIACYATGSTVGYNYLRGEFHHEpFENFELALADAYANGWLGKNI 167 Xanthomonas cam...
WP_011715169  74 PRPKYLVCNADEGEPGTCKDRDLMRFDPHLLIEGMIIAGYAVNSKQGYIYIRGEFYRE-AEVLEAAVAEAYAANLLGKNI 152 Magnetococcus m...
P31979       161 MGTGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPATSGAWGKPTCVNNVETLCNVPAILANGVEWYQNIS 240 Escherichia col...
Q8K9Y3       161 LNSGFNFELFLHTGAGRYICGEETALINSLEGRRANPRAKPPFPAVFGLWGKPTCVNNVETLSNVPSIVLHGVNWYKKLS 240 Buchnera aphidi...
P95176       164 GGSGFDLELVVHAGAGAYICGEETALLDSLEGRRGQPRLRPPFPAVAGLYGCPTVINNVETIASVPSIILGGIDWFRSMG 243 Mycobacterium t...
P56912       153 NKLGYDIDIYVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANMGLYGCPTTVNNVESIAVTPTILRRGAGWYTSFG 232 Sinorhizobium m...
Q9ZE33       153 CGSGFDCNIYLHRGAGAYICGEETALLESLEGKKGMPRLKPPFPAGFGLYGCPTTINNVESIAVVPTILRRGASWFAAIG 232 Rickettsia prow...
P56913       152 LGSGFNFMVHIHRGAGAYICGEETAMLESLEGKRAQPRLKPPFPAVAGLYASPTVINNVETLACVPHIVMRGSAWFRGIG 231 Sinorhizobium m...
WP_010954901 169 LGSGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPAAVGVWGKPTCVNNVETLCNVPAIVANGNDWYKSLA 248 Pseudomonas putida
WP_014573730 158 LGSDFEFELFAHHGYGAYICGEETALLESLEGKKGQPRFKPPFPASFGLYGKPTTINNTETFSSVPFIIRDGGQAFADKG 237 Neisseria menin...
WP_000829484 152 LGSGFDFDLILYEGAGAYICGEETALINSLEGRRGHPRLKPPFPAVSGLYRSPTVVNNVETFSAIPHILDKGADWYSKIG 231 Leptospira inte...
WP_011037654 168 LGSGVDIDIYGALGAGAYICGEETALMESLEGKKGQPRYKPPFPANFGLYGKPTTINNTETYASVPAIIRNGPEWFLGLS 247 Xanthomonas cam...
WP_011715169 153 LGKGVDFDLAVHRGAGAYVCGEESALLNSLEGEKGQPRLKPPFPANVGLYGCPTVINNVETLCAVPAILEKGGAWYSKLG 232 Magnetococcus m...
P31979       241 -KS--KDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGL-K-FKAWQPGGAGTDFLT-EAHLDLPMEFESI 314 Escherichia col...
Q8K9Y3       241 kST--DTTGTKLMGFSGKVNNPGVWELPFGTTAREILEDYARGMKSGL-F-LKSWQPGGAGTDFLI-EKHLDLPMDFTSI 315 Buchnera aphidi...
P95176       244 s-E--KSPGFTLYSLSGHVTRPGQYEAPLGITLRELLD-YAGGVRAGH-R-LKFWTPGGSSTPLLT-DEHLDVPLDYEGV 316 Mycobacterium t...
P56912       233 r-P--NNHGTKLYSVSGHVNRPCTVEDAMSIPFHELIEKHCGGIRGGW-DnLLAVIPGGSSVPCVPgAQMKDAIMDYDGL 308 Sinorhizobium m...
Q9ZE33       233 k-P--NNTGTKVFCISGHVNKPCNIEEVMGVPLKELIEKYAGGVRGGW-NnLKAIIPGGASVPLLPkSLCE-VEMDFDSL 307 Rickettsia prow...
P56913       232 p-D--RSPGPKLYCLSGQVRKPGLYELPMGISLRELVEEHAGGPLPGR-K-VKAVIPGGVSAPVIP-EGELEVGMDFDSL 305 Sinorhizobium m...
WP_010954901 249 -REgsEDHGTKLMGFSGKVKNPGLWELPFGVTARELFEDYAGGMRDGF-K-LKCWQPGGAGTGFLLpE-HLDAQMYAGGI 324 Pseudomonas putida
WP_014573730 238 -IP--NAGGTKLFCISGHVERPGNYEVPLGTPFAEVL-KMAGGMRGGK-K-LKAVIPGGSSAPVLPaDIMMQTNMDYDSI 311 Neisseria menin...
WP_000829484 232 -TE--KSPGTRLFSVSGHVKKPGVYEIELGTPLLELVNDLCGGIIDDK-P-LKAIIPGGSSVPILTaEECKTANMDFESM 306 Leptospira inte...
WP_011037654 248 -KT--KNGGPKIFSVSGCVQKGGNFEVPLGTTFDELLE-MAGGLRPGR-K-LKGVVPGGVSMPVLKaDQVAGLQMDYDTL 321 Xanthomonas cam...
WP_011715169 233 -VE--KSSGTKLFSVSGHVNKPGNYEVELGIPLKSLINDYAGGVRGGWeN-LKGVIPGGSSTPVLIpEQCETILMSYEAL 308 Magnetococcus m...
P31979       315 GKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLG-P 393 Escherichia col...
Q8K9Y3       316 AKAGSRLGTAIAMAVDNKTNMISLVCNIEKFFSRESCGLCTPCREGLPWIVKILESLEKKEGHKNDVKNLERLCLDLS-P 394 Buchnera aphidi...
P95176       317 GAAGSMLGTKALEIFDETTCVVRAVRRWTEFYKHESCGKCTPCREGTFWLDKIYERLETGRGSHEDIDKLLDISDSIL-G 395 Mycobacterium t...
P56912       309 RELGSGLGTAAVIVMDKSTDIIKAIWRLSAFYKHESCGQCTPCREGTGWMMRVMERMVQGRAQKREIDMLFDVTKQVE-G 387 Sinorhizobium m...
Q9ZE33       308 RTVGSGLGTGGIIVMDKSTDIIYAIARLSKFYMHESCGQCTPCREGTGWMWRVMMRLVNGNAKKNEIDTLLNVTKEIE-G 386 Rickettsia prow...
P56913       306 TAAGSMLGSAGVVVIDDSTCMVKLATRIIEFFHHESCGKCTPCREGLDWTVKVLRRIEAGEGETGDLEQLEMLCKGIF-G 384 Sinorhizobium m...
WP_010954901 325 AKVGTRMGTGLAMAVDDSINMVSLLRNMEEFFARESCGWCTPCRDGLPWSVKMLRALENGQGRAEDIETLLGLVNFLGpG 404 Pseudomonas putida
WP_014573730 312 SKAGSMLGSGAIIVMDEDVCMVKALERLSYFYYDESCGQCTPCREGTGWLYRIVHRIVEGKGKMEDLDLLDSVGNQMA-G 390 Neisseria menin...
WP_000829484 307 AAHKTMLGSGAVIVLAEGTDIVETTYRFARFYAHESCGQCTPCREGTHWVRDILYKIREGEGTTEDIDLIFSLSRNMEgG 386 Leptospira inte...
WP_011037654 322 RALGTGLGSGAIVVLDDSVCCVRFACRISQFFHKESCGQCTPCREGTGWMHRVLERIVAGKATMEDLHQLRTVAGQIE-G 400 Xanthomonas cam...
WP_011715169 309 AGAGSMLGAGSVIVMDKSTCIVKAIARLSKFYRHESCGQCTPCREGTGWLAQIMDRIETGQGREGDIDLLLSVCSNIQ-G 387 Magnetococcus m...
P31979       394 gKTFCAHAPGAVEPLQSAIKYFREEFEAGI 423 Escherichia coli K-12
Q8K9Y3       395 gKTFCAHAPGAVEPLQSAIKYFRLEFEAGI 424 Buchnera aphidicola str. Sg (Schizaphis graminum)
P95176       396 -KSFCALGDGAASPVMSSIKHFRDEYLAHV 424 Mycobacterium tuberculosis
P56912       388 -HTICALGDAAAWPIQGLIKHFRPEMEKRI 416 Sinorhizobium meliloti 1021
Q9ZE33       387 -HTICALGDAAAWPIQGLIRHFRDEIEQRI 415 Rickettsia prowazekii str. Madrid E
P56913       385 -NTFCALGDGAAMGLRAALKHFRAEFVAHI 413 Sinorhizobium meliloti 1021
WP_010954901 405 -RTFCAHAPGAVEPLGSAIKYFRSEFEAGV 433 Pseudomonas putida
WP_014573730 391 -RTICALADAAVFPVRSFTKHFRDEFVHYI 419 Neisseria meningitidis
WP_000829484 387 -TTICPLSDACVGAVRPALQKFRSEFDAKL 415 Leptospira interrogans
WP_011037654 401 -HTICAFGEAAAWPIQGFLRQFWDEFEYYI 429 Xanthomonas campestris
WP_011715169 388 -KTICALGDAAAMPVVGAIRHFRDEFEYHV 416 Magnetococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap