2OUG


Conserved Protein Domain Family
RfaH

?
TIGR01955: RfaH 
Click on image for an interactive view with Cn3D
transcription elongation factor/antiterminator RfaH
This model represents the transcription elongation factor/antiterminator, RfaH. This protein is most closely related to the transcriptional termination/antitermination protein NusG (TIGR00922) and contains the KOW motif (pfam00467). This protein appears to be limited to the gamma proteobacteria. In E. coli, this gene appears to control the expression of haemolysin, sex factor and lipopolysaccharide genes. [Transcription, Transcription factors]
Statistics
?
PSSM-Id: 131010
View PSSM: TIGR01955
Aligned: 6 rows
Threshold Bit Score: 238.515
Threshold Setting Gi: 492141662
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OUG_A                4 WYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEV-IHTTTINATRGVSHFVRFG 82  Escheric...
P26614                4 WYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEV-IHTTTINATRGVSHFVRFG 82  Escheric...
lhbprmlnih:CBU_0826   7 WYLIYTKPRQERIAEENLERQGYRIYLPFIQVNRRRSGCYQLITEPLFPRYLFILLNIDK-DNWGPIRSTRGVSALVRFG 85  Coxiella...
WP_000833004          4 WYLLYCKRGEQQRAKMHLENQSVECFYPEVCVEKILRGKRQMVQEPLFPSYMFVRFDFENgPSFTTVRSTRGVVDFVRLG 83  Vibrio c...
WP_011073081          4 WYLLYCKPRSEVRAQQNLALQNLETYLPMVSEEKSQRGQKRICRVPLFPNYLFINFDPSQ-TSVKQVHSTRGVSRIVNCQ 82  Shewanel...
WP_005760598         10 WYLIQTKPRQEARAEEHLRRQDFECFRP-LRAAAKKIAAKAQVEEALFPGYLFIHMDQVH-DNWYPIRSTRGVSRIVTFG 87  Pseudomo...
2OUG_A               83 ASPAIVPSAVIHQLSVYKPKDIVDPAT----PYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTE 158 Escheric...
P26614               83 ASPAIVPSAVIHQLSVYKPKDIVDPAT----PYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTE 158 Escheric...
lhbprmlnih:CBU_0826  86 GIPAKVPPDFVQFLKNNETSASVPPKVs--lFQKGQRVQIIDGVMAGYEGVFEMHSGAKRVTLLLDMVGKVTRVEVPLDS 163 Coxiella...
WP_000833004         84 PHPRELQGDLIYQLKQLDCEQLKHATKq--lPEKGQTVRVARGQFAGIEAIYLEPDGDTRSIMLVKMISQQVPMSIENTD 161 Vibrio c...
WP_011073081         83 EKMTPIDDRIIHAIRMKELTPSQSVLDtpleLKTGEKIRFKDGPFADLEAIFQEKCPNKRCHVLFNIMGQINILTVPEQS 162 Shewanel...
WP_005760598         88 GHPVPVRDHLIEQIRQR---LCTPAPAl--rFTQGDQVMITTGSWCDVEAIFLTTDGTERAVILLNMLQRQQKVVLPISS 162 Pseudomo...
2OUG_A              159 FR 160 Escherichia coli
P26614              159 FR 160 Escherichia coli
lhbprmlnih:CBU_0826 164 VT 165 Coxiella burnetii RSA 493
WP_000833004        162 WE 163 Vibrio cholerae
WP_011073081        163 VE 164 Shewanella oneidensis
WP_005760598        163 LS 164 Pseudomonas syringae group
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap