2ZHG


Conserved Protein Domain Family
SoxR

?
TIGR01950: SoxR 
Click on image for an interactive view with Cn3D
redox-sensitive transcriptional activator SoxR
SoxR is a MerR-family homodimeric transcription factor with a 2Fe-2S cluster in each monomer. The motif CIGCGCxxxxxC is conserved. Oxidation of the iron-sulfur cluster activates SoxR. The physiological role in E. coli is response to oxidative stress. It is activated by superoxide, singlet oxygen, nitric oxide (NO), and hydrogen peroxide. In E. coli, SoxR increases expression of transcription factor SoxS; different downstream targets may exist in other species. [Cellular processes, Detoxification, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131005
View PSSM: TIGR01950
Aligned: 6 rows
Threshold Bit Score: 231.217
Threshold Setting Gi: 37999968
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZHG_A        11 LLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAIIKIAQRIGIPLATIGEAFGVLPEGHTLSAKE 90  Escherichia col...
P22538        11 LLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAIIKIAQRIGIPLATIGEAFGVLPEGHTLSAKE 90  Escherichia coli
Q51506         9 ELSVGELARRAGVAVSALHFYETKGLISSQRNAGNQRRFSRETLRRVVVIKVAQRVGIPLAEIARALQTLPAGRSPSAAD 88  Pseudomonas aer...
WP_000426186   2 EMTVGDVAQRAGVKVSALHFYEQKGLIHSWRNQGNQRRYDRSVLRRIAVIKAAQMVGLTLEEIAEALAHLPKHEAPTRQD 81  Vibrio cholerae
Q9ZHI4         5 TITIGRLAKRTGVAASALRFYEARGLIHSVGEAGKTRRYRRDAIRRVSFIRVAQAMGMSLQDIGAALADLPSQRTPTADD 84  Chromobacterium...
WP_003977128  10 ELTVGQLADRSGAAVSALHFYESKGLITSRRTSGNQRRFARDALRRVAFVRAAQRVGIPLATIREALAELPEGRTPTEDD 89  Streptomyces
2ZHG_A        91 WKQLSSQWREELDRRIHTLVALRDELDGCIGCGCLSRSDCPLRNPGDRLGEEGTGARLLEDE 152 Escherichia coli K-12
P22538        91 WKQLSSQWREELDRRIHTLVALRDELDGCIGCGCLSRSDCPLRNPGDRLGEEGTGARLLEDE 152 Escherichia coli
Q51506        89 WARLSAQWKEDLTERIDKLLLLRDQLDGCIGCGCLSLQACPLRNPGDQLSAEGPGAHWLDAE 150 Pseudomonas aeruginosa PAO1
WP_000426186  82 WQQMASHWHHFLDHRIQQLNALKEDLSGCIGCGCLSLESCAIYNPKDIRAMTFADKTRLSHP 143 Vibrio cholerae
Q9ZHI4        85 WARISQAWKPLLQERIDALCRLRDQLDSCIGCGCLSLERCKLYNPDDKAGEQGCGPRFLLDE 146 Chromobacterium violaceum ATCC 12472
WP_003977128  90 WARLSESWRSELDERIKQLNRLRDHLTDCIGCGCLSLETCVLSNPDDAFGERSAGSRLLVER 151 Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap