Conserved Protein Domain Family
rnfE

?
TIGR01948: rnfE 
electron transport complex, RnfABCDGE type, E subunit
The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the E subunit. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 162619
View PSSM: TIGR01948
Aligned: 9 rows
Threshold Bit Score: 272.293
Threshold Setting Gi: 490722231
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9KT91         5 RTLMLNGMWNNNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVRDYVPKEVRIPVFVMIIASLVTCVQ 84  Vibrio cholerae...
Q9HYB5         7 REIARNGLWRNNPGLVQLLGLCPLLGTSNSTVNALGLGLATMLVLACSNAAVSLVRGAVSEAIRLPAFVMIIAVLTTCIE 86  Pseudomonas aer...
Q9F5Y1        18 WQYFTSALWQYNVALVQMLALCPTLAVTTTATNGLGMGLATTLVLVMTNALISSMRHTISPEVRNPVMIGVIAGVVTLTD 97  Azotobacter vin...
Q8KA17         4 KKFFKKRLWNNNSSLVQLLGLCPILAMTTNTINAIGLGITTTFVLTITNSIISILKNFIPKDIRIPIYMIIVSSTVTCIE 83  Buchnera aphidi...
WP_011712366   7 REIVANGFWNNNAVFAQLLGMCPLLGVTTTAMNGIGMGLASLVVLLGANVVVAMVRSYIPSEVRIPSYIVVIASFVTIVD 86  Magnetococcus m...
WP_011010212   5 FERLKNGIVTENPIFVQVLAMCPTLAVTSSVENAVGMGIASTVVLIFSNMIISALRKFIPNKIRIPAYIVIIASFVTVVD 84  Clostridium per...
WP_004082951   4 LRELTKGIIKENPTYVQVLGMCPTLAVTTSAINGLGMGLATTAVLTMSNVVISLIRKIVPDKIRIPIFIVVIASFVTMID 83  Thermotoga
WP_011020709  12 ISEFIRGITKDNPTFGLVLGLCPTLAVTTSVENGIGMAMGTLFVLVGSNMMVSAIRKGIPGTVRLPVEIIVIATFVTIVD 91  Methanosarcina ...
WP_004584791   5 LSVIINGIIKENPTFVLLLGMCPTLATTTSAINGMSMGLATMFVLICSNMVVSLVKNLIPDMVRIPAFIVIIAGFVTILQ 84  Porphyromonas
Q9KT91        85 LLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFASKNDVLPAALDGFWMGLGMTSVLVVLGSLREIIGNGTLFDgadll 164 Vibrio cholerae...
Q9HYB5        87 LLMQAWTYELYQVLGIFIPLITTNCVILGRAEAFAAKNGVLRASFDGLLMGLGFALVLLVLGGLRELLGQGTLLAdmhll 166 Pseudomonas aer...
Q9F5Y1        98 MAMNAWMHELYKVLGLFIALIVTNCAVLGRAESFCLRNPVIPSILDGAGMGAGFTAVLVVIGGIREILGSGTLFSqassl 177 Azotobacter vin...
Q8KA17        84 MLLHAYQFNLYQSLGVFIPLIVTNCIVVGRADCIAYKSSFVISFLDGMSIGLGSTFAMFVIGSIREILGNGTFLFganki 163 Buchnera aphidi...
WP_011712366  87 LCMNAWLHDLHKILGLFIPLIVVNCAILGRAEAFASRNSVGKSAIDGIATGLGFTFALFVLGAVREILGAGEI------- 159 Magnetococcus m...
WP_011010212  85 MLMNAYVQSLYKSLGIFIPLIVVNCVILGRAEAYASNNKILPSIFDAIGMGIGFTIALFSIGTFREILGAGTFL------ 158 Clostridium per...
WP_004082951  84 LLMHGFAYDLWKTLGLFIPLIVVNCIIMGRAESFASKHGVLDSMLDGLGVGLGFTGSLVLLGSVRELFGNGTI------- 156 Thermotoga
WP_011020709  92 MVMEAFTPDLYTSLGVFIPLIVVNCIVIGRAEAYALKNGVFYSIIDALGEGTGFLLVLILIGGIRELLGTGIIDP----- 166 Methanosarcina ...
WP_004584791  85 MLIKAYMPDLDKSLGIFIPLIVVNCIVLGRAEAVASKKGLLHSMFDGIGIGLGFTLSLTVLGIVRELLGSGKLFD----- 159 Porphyromonas
Q9KT91       165 lgewAKVLRIEVFHFDSAFLLALLPPGAFIGVGFLIAAKSVIDKQ 209 Vibrio cholerae O1 biovar El Tor str. N16961
Q9HYB5       167 fgpaAADWKIQPFPQYQGFLLAILPPGAFIMLGLLIALKNRIDES 211 Pseudomonas aeruginosa PAO1
Q9F5Y1       178 lgshFKWMEITVIPDFQGILLAILPPGAFIVLGFLLAAKRVIDRK 222 Azotobacter vinelandii DJ
Q8KA17       164 fnvlDHSFFFTFIDKNSTIILAMLPSGGFLVLGFVIAFKNYLDLG 208 Buchnera aphidicola str. Sg (Schizaphis graminum)
WP_011712366 160 ----FGYDVMSWSG-FHPALGFVLPPGAFIALGFILMGVKWLNER 199 Magnetococcus marinus
WP_011010212 159 -----GMNIMPEG--FKPATIMILAPGAFLTLGALMTFLNYRNIK 196 Clostridium perfringens
WP_004082951 157 ----FGYKVWELK-----IFLEILPPGAYITLGLLSALFTYIGIR 192 Thermotoga
WP_011020709 167 ----FGMTLINLSGVINPAMFMTMSPGAFLTIAVLMTIVNYRRQQ 207 Methanosarcina acetivorans
WP_004584791 160 ----FA-----VFNESYGALIFVLAPGAFIALGYLIALVNKMKKK 195 Porphyromonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap