Conserved Protein Domain Family
rnfD

?
TIGR01946: rnfD 
electron transport complex, RnfABCDGE type, D subunit
The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the A subunit. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131001
View PSSM: TIGR01946
Aligned: 10 rows
Threshold Bit Score: 381.328
Threshold Setting Gi: 499319941
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57288         7 SPHTHSGKLTAHIMLWAILAMMPAFFTQIYYFGFGVVLQSALAIGTAIIAEFIAIKLRGKKPLNYLSDFSVALTALILAM 86  Haemophilus inf...
P57216         3 FPCIYHVYSIRKIMFLVIVACLPGIFAKYYFFGIGTLIQIFFSIFISLVLEIIILKIRSKNIKNYLQDTSLVLTSVLFGV 82  Buchnera aphidi...
P76182         8 SPYTHNQRQTSRIMLLVLLAAVPGIAAQLWFFGWGTLVQILLASVSALLAEALVLKLRKQSVAATLKDNSALLTGLLLAV 87  Escherichia col...
Q9KT89         8 SPHLRSKRSTADVMRWVLACALPGLIAQTYFFGYGTLIQLLLAISVAVALEAGIMLLRKRSPISALRDYSAVVTAWLLAV 87  Vibrio cholerae...
Q9HYB7         8 SPHARGSNRTPAIMRLVLGACVPGLLTLTWLYGPGTLLNLAWASLVALACEAAMLALRKRPPGVFLKDGSALVTALLLAV 87  Pseudomonas aer...
WP_011072474   8 SPHVTRNLQTSTVMQRVILCLLPGLVVQCAFFGWGTLIQVLLAIIVALSCEAAVMKLRKRSIKASLGDNSAMLTAILIGV 87  Shewanella onei...
WP_004082949   8 APHLREEDDVRKIMLDVLIALSPAVIGAAYFFGWYALFLCIAGAVIGELFDIFVMRYLRG-VKDFVPDGSGAVTGLLLAM 86  Thermotoga
WP_004584789  10 SPHIHSGDSIKKNMYGVLIALLPALAMSVYQFGIGAVIVTAVSVLTCCIVEYLISKYMLGK-EPTIMDGSAILTGVLLAF 88  Porphyromonas g...
WP_011015691  10 APHIRTAETVESVMYDVVIALIPAFAMAVYTFGVRALILTAVSVLTCILTEYLCQKALKRDIEAF--DGSAILTGILFSF 87  Fusobacterium n...
WP_011010433  27 SPHIKDKLSTQSIMRDVLIALIPTSLVGVLVFGLRAIFIIATCAISAVISEYAFQKITKKEI--TIKDLSAIVTGVLLAL 104 Clostridium per...
Q57288        87 AIPPYAPYWIIIIGTLCAVLLGKQVYGGLGQNPFNPAMIGYVILLISFPLQMTTWMPPINLL----QepptFSDAFSLIF 162 Haemophilus inf...
P57216        83 SIPPLLPWWMTSIGLFFAIVVAKHLYGGIGQNIFNPAMVGYAVLLISFPVYMNNWNERDFSL----SffndFKKSAYIIF 158 Buchnera aphidi...
P76182        88 SIPPLAPWWMVVLGTVFAVIIAKQLYGGLGQNPFNPAMIGYVVLLISFPVQMTSWLPPHEIA----VnipgFIDAIQVIF 163 Escherichia col...
Q9KT89        88 AIPPLSPWWVVVIGLIFAIVIAKHLYGGLGQNPFNPAMIAYVVLLISFPVQMTSWMAPIKLT----AepssLVDSFSLIF 163 Vibrio cholerae...
Q9HYB7        88 ALPPYAPWWLTLVATFFALVFGKHLYGGLGQNPFNPAMLGYVVALVSFPLEMTRWPSPDSAL----G----LPDSLREFL 159 Pseudomonas aer...
WP_011072474  88 AIPPLAPWWMIVMGTAFAIVIVKHLYGGLGHNLFNPAMAAYVLLLVSFPLQMTTWIAPSTVAlntpS----IVDSLQLIF 163 Shewanella onei...
WP_004082949  87 NVSTRLPFWAFLLGLVFALGIGKHVFGGLGQNIFNPALVGRAFLLISFPTYMTTWVVPGAGF----W------------- 149 Thermotoga
WP_004584789  89 NLPSNLPVWIIIIGAVVAIALGKMSFGGLGNNIFNPALVGRVFLLISFPAQMTLWPTEGQM------------------- 149 Porphyromonas g...
WP_011015691  88 VVPAIMPLQYVVVGNIVAITLGKMVYGGLGHNIFNPALVGRAFVQASWPVAITTFAFDGK-------------------- 147 Fusobacterium n...
WP_011010433 105 NLPINTPLWVACIGSIVAIVLVKQIFGGIGCNFMNPALAARAFLLAAWPESISIFT------------------------ 160 Clostridium per...
Q57288       163 SGLTTdgftlsqlthNIDGITQATPLDSAKIFYkSH-TQLNdfyeLIKLPIFMGNgtDFAQGWWQINVAFLAGGIFLILK 241 Haemophilus inf...
P57216       159 FKNDIttvsssylniIPDAFTTATPLNNFKIKS-HL-KDDF----FLKENIIKNKevSIQTSWKCINISFFLGGIFLLFT 232 Buchnera aphidi...
P76182       164 SGHTAsggdmntlrlGIDGISQATPLDTFKTSVrAG-HSVEq---IMQYPIYSGI--LAGAGWQWVNLAWLAGGVWLLWQ 237 Escherichia col...
Q9KT89       164 GGFDSdglslqqirtGIDGITMATPLDAFKTSLkAG-HTMSe---TLTQPQFSG---FAGIGWEWVNIAYLLGGLILLKL 236 Vibrio cholerae...
Q9HYB7       160 GLATR-----------PDAWAHATALDVLKTDRsLT-VDEL----FAGNPAFGH---LGSAGSEWVNLAFLLGGLFLLWR 220 Pseudomonas aer...
WP_011072474 164 NVGAHvgme--qfrlGIDGISMATPLDTLKTDLsLGlTTTE----SMAKSIFDG---STGVGWFWVNLAYLAGGIVLLKL 234 Shewanella onei...
WP_004082949 150 ---KS----------PADVVTAATPLALFKEHG------VF----TPYWDLFIGK--VGGSLGETSALLLIIGFIYLLLR 204 Thermotoga
WP_004584789 150 ---TS----------YLDAETGATPLGLMKAAMsGD-TSALan-iPTDLHMFIGE---AGSLGEVSAIALLLGLVYMLYK 211 Porphyromonas g...
WP_011015691 148 --------------------AGATVLDAMKRGIpLS-DALLen-tNQYIDAFLGQ--MGGCLGETSSLALLIGGAYLIYK 203 Fusobacterium n...
WP_011010433 161 ----------------LDGITTATPLALLKNGQgN-----L----PPLSNAFLGN--IAGCIGEVSSLAILIGALYLLYR 213 Clostridium per...
Q57288       242 RVIHWQIPVAMLVTFFCLATATAFTG--FTHLSAISQLVSGAMMFGAFFIATDPVTASITPRGKIIFGALVGLFVYLIRY 319 Haemophilus inf...
P57216       233 KIICWRIPISFLSSLGMLSIITYFYSk-ELFMSPQVHFFSGGTMICAFFIATDPVTAACNNVGKIVFGIIIGFLVWIIRN 311 Buchnera aphidi...
P76182       238 KAIRWHIPLSFLVTLALCAMLGWLFSp-ETLAAPQIHLLSGATMLGAFFILTDPVTASTTNRGRLIFGALAGLLVWLIRS 316 Escherichia col...
Q9KT89       237 RIIRWHIPMAMLAGLVFTALLAQLFAp-GTTASPMIHLLSGATMLGAFFIATDPVSASTTDKGRLIYGFFIGAMVFLIRS 315 Vibrio cholerae...
Q9HYB7       221 RLFTWHAPLGMLAGLFAMSLLFWNGSgsDSHGSPLFHLFSGATMLGAFFIVTDPVSGATSNRGRLVFGLGVGVLTYVIRA 300 Pseudomonas aer...
WP_011072474 235 KAIRWHISTGVLAGLFVASSVGFLLSp-DTHASPLFHLFSGATMLAAFFIATDPVTAATSPRGRIIFGALIGVLVYIIRT 313 Shewanella onei...
WP_004082949 205 KRVKIFIPVSYIGTVLVFSSIAYLMNp-R-YGDPLFHLLSGGLMLGALFMATDMVTSPITAKGQVIFGIGCGVLTMAIRL 282 Thermotoga
WP_004584789 212 KIITWHIPVSIFASVIVLAGILHLASptSFPATPWFHLFSGGMMLGAIFMATDYVTSPMTKSGQILYGCLIGLLTVVIRT 291 Porphyromonas g...
WP_011015691 204 KHIDWKVPAVMIGTVFVLTWAMG--------ADPLMQIFSGGLFLGAFFMATDMVTSPTTSKGRVVFALGLGVLISLIRM 275 Fusobacterium n...
WP_011010433 214 KVITWHIPLVYISTVLILTTIIGRNG--FLSGNGIYEIFTGGLFLGAFFMATDYVTSPLTKKGQIIFAFGCGLITTLIRI 291 Clostridium per...
Q57288       320 HGNYPDGVAFAILLSNICVPLIDHYTRPRVSGY 352 Haemophilus influenzae Rd KW20
P57216       312 YSDYPDAIAFSVLFANMTVPLVDYYTKSSGYGR 344 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
P76182       317 FGGYPDGVAFAVLLANITVPLIDYYTRPRVYGH 349 Escherichia coli K-12
Q9KT89       316 WGGFPDGVAFAVLLANMCVPLIDYYTKPRTYGH 348 Vibrio cholerae O1 biovar El Tor str. N16961
Q9HYB7       301 WGGYPDGVAFAVLLMNLAAPTIDYYTRPRTYGH 333 Pseudomonas aeruginosa PAO1
WP_011072474 314 QGGYPDAFAFAVLLANLCAPFIDYYVRPRTYGH 346 Shewanella oneidensis
WP_004082949 283 FGAYPEGVSFSILFMNALVPLIDRYTRPRIFGE 315 Thermotoga
WP_004584789 292 FGAYPEGMSFAILIMNGMTPLINTYMKPKHFGG 324 Porphyromonas gingivalis
WP_011015691 276 KGGYPEGTAYAILIMNGVVPLIDRYIRPKKFGG 308 Fusobacterium nucleatum
WP_011010433 292 FGGYPEGVSYSILLMNLLVPVIDYYIKPKAFGN 324 Clostridium perfringens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap