Conserved Protein Domain Family
rnfA

?
TIGR01943: rnfA 
electron transport complex, RnfABCDGE type, A subunit
The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the A subunit. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 130998
View PSSM: TIGR01943
Aligned: 8 rows
Threshold Bit Score: 222.613
Threshold Setting Gi: 25091187
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P76181         2 TDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLIYLRTLAFILVI 81  Escherichia coli
Q07396         2 QDFLLVLLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVITVASAACWLVEALILEPLDLKFLRILSMILVI 81  Rhodobacter cap...
Q8KA21         2 KSYFFFILSNILIDNFILVKFLGLCPFIGASNQIKQAFGISFATSFVVVVSTVLLWFVNFFILLPFDLVYLRIIVYMLII 81  Buchnera aphidi...
WP_011712371   7 SNFLLILISTVFVNNYVLAKFLGICPFLGVSKKVETAVGMTQAVMFVMTLASVISWLVQHYILDPLNLGYLQTISFILII 86  Magnetococcus m...
WP_011010213   1 MELFLIFIGAMLVNNFVLSQFLGICSFIGVSKKKEAAVGMGLAVTFVMVLASIISWLVYNLILDKFNITYLKTIVFVLVI 80  Clostridium per...
WP_004082952   1 MKVFLLFFSAIFVNNFVLARFLGICPFLGVSKRLETATGMGIAVTFVMTVSAAISWFLDKL-LISTGLEFLRTIVFILVI 79  Thermotoga
WP_005874209   1 MEFFMLFIAAVFVNNVVLSQFLGICPFLGVSKKVDTSIGMGAAVTFVLALATLVTFLIQKFVLDRFGLGFMQTIAFILVI 80  Porphyromonas
WP_011020710   6 eSLFTIFLEGVFIKNFLLIQFLGLCSFVGVTKDLKSASGMSGAVVFVMAMAATVSFALYNFILVPLKLEFLRTIAFIVVI 85  Methanosarcina ...
P76181        82 AVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVA 161 Escherichia coli
Q07396        82 AAIVQFIETVMRKVTPDLHKALGIYLPLITTNCAVLGLPLMYIQGHLSLAMSTLSGFGASVGFTLVLVIFAGMRERLAQL 161 Rhodobacter cap...
Q8KA21        82 SFGVQLIEIILRGTSPILYRILGIFLPLITTNCAVLAIPLFSLYLNHTFLESILYAVSASFGFTLVMVIFSSIRERILLS 161 Buchnera aphidi...
WP_011712371  87 ASLVQLTEMVVHKTSPVLYASLGIFLPLITTNCAVLGVALLNIQQENNLINASFYGVGAGLGFGLVLILFAGMRERVDLS 166 Magnetococcus m...
WP_011010213  81 ASLVQFVEMVVKKYSPSLYKALGIFLPLITTNCAVLGMAVTNVEEVYNLIQSIVHALGAAGGYMLAIVLMSFLREKIDDN 160 Clostridium per...
WP_004082952  80 ASFVQFVELFLKKTSPDLYEALGIFLPLITTNCAILGMVLLNSLMKLNFVEAVFHALGSGLGFALALVIFAGIREKMDLY 159 Thermotoga
WP_005874209  81 AALVQMVEIILKKVSPPLYQALGVFLPLITTNCCVLGVAILVIQKDYTLLQSFVYAISTAIGFTLAMVTFAGIREQLDMT 160 Porphyromonas
WP_011020710  86 AALVQLVEFIVRKHVPALYRSLGIYLPLITTNCAVLGAVLLNVMNDYDLAQSVVFGVAAGLGYTVAMLMMAAIRERSDLV 165 Methanosarcina ...
P76181       162 -DVPAPF-RGNAIALITAGLMSLAFMGFSGLV 191 Escherichia coli
Q07396       162 -SVPAAF-AGTPIAFVSAGLLGLAFMGFAGLV 191 Rhodobacter capsulatus
Q8KA21       162 -DVPLAF-QGSPIVLITVSLISIVFMGFKGLV 191 Buchnera aphidicola str. Sg (Schizaphis graminum)
WP_011712371 167 -DVPRLF-KGSPISLINAGLMSLAFMGFAGLV 196 Magnetococcus marinus
WP_011010213 161 eEIHPYF-RGLPITLFTAALMSIAFLGFQGLI 191 Clostridium perfringens
WP_004082952 160 -DLPEPF-KGTAIALITAGLLSLAFMGFQGMV 189 Thermotoga
WP_005874209 161 -NLPKAM-KGIPSALLAAGILAMAFMGFSGIA 190 Porphyromonas
WP_011020710 166 -EVPKSVgRGVTYAFFIATIMSMSFVNFFGVI 196 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap