Conserved Protein Domain Family
pcnB

?
TIGR01942: pcnB 
poly(A) polymerase
This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).
Statistics
?
PSSM-Id: 130997
View PSSM: TIGR01942
Aligned: 5 rows
Threshold Bit Score: 514.347
Threshold Setting Gi: 499184502
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011071162  43 LVPRDAHSISRKQISENALKVLYRLNKAGFQAYLVGGGVRDLLLGLEPKDFDVVTNATPEEIKKLFRNCRVVGRRFRLAH 122 Shewanella onei...
WP_010955347  25 VINKSQHSLQRHQFSRHAVNIVERLQSAGYQAYLVGGCVRDLMLGITPKDFDVATSATPEQVRAEFRNARIIGRRFKLVH 104 Pseudomonas putida
WP_002246109  24 VIPAERHNIRAEMLSFAAENVIRRLKGAGFQAYVVGGAIRDLLLGIEPKDFDVATDAMPEQVHKLFRRSRIVGRRFQIVH 103 Neisseria menin...
WP_010882042  19 VYTESEHGIPRQSVDAGAIRVVEALVGAGYETYIVGGAVRDLVAGRTPKDFDIVTGAVPSRIRRLFRNSRIIGRRFRIVH 98  Treponema pallidum
WP_010725189  29 IFYPSDHNIDLQSFSTHALSVVRTLKKAGYEAYIVGGCIRDLLLKTEPKDFDISTSAKPEEVKTLFKNCILVGKRFRLAH 108 Chlamydia trach...
WP_011071162 123 IVFGRDVIEVATFRG---------HHgesnekISKANAEGRLLRDNVYGEIDEDAERRDFTVNALYYDISDYSIRSYGGG 193 Shewanella onei...
WP_010955347 105 VHFGREIIEVATFRAhhseddqgdAH------RSSHNASGRILRDNVYGTLEEDAQRRDFTINALYYDPVSERILDYANG 178 Pseudomonas putida
WP_002246109 104 VMNGAEIIEVTTFRG---------GA------KVHQNAHGRIMKDNTYGSIEEDAMRRDFTCNALYYDPEKEEILDFHNG 168 Neisseria menin...
WP_010882042  99 VSCGSQLYEVSTFRS-------------------RVG-EGSVCVP---GTLEEDAWRRDFSVNALYYDPLRNVVIDCVGG 155 Treponema pallidum
WP_010725189 109 IRFPNQIIEVATFRS------------------GSNEEDSLITKDNLWGSAEEDVLRRDFTINGLFYDPSAEIIIDYTGG 170 Chlamydia trach...
WP_011071162 194 MEDLKAGTLRLIGDPETRYREDPVRMLRAVRFATKLSMTIDEVTAKPIKQLAPLLKDIPAARMYEEVLKLFFAGKAVANF 273 Shewanella onei...
WP_010955347 179 VHDVRNRLLRLIGDPTHRYQEDPVRMLRAVRFAAKLDFGIEKHTYLPIRGLAPMLREIPPARLFEECLKLFLSGQGAIAF 258 Pseudomonas putida
WP_002246109 169 IADVAARRLVMIGDAAERYQEDPVRILRAIRLSGKLGFELSEETAAPIAESICRLKHEPVARLFDEIMKLLFSGHARECL 248 Neisseria menin...
WP_010882042 156 MVDLKRRRVRPLIPLRSIFVEDPVRMLRALKCSVMCESSIPFSVRRSIRRSVSLLGGCSPSRLTDEFVKILFSGRSAALV 235 Treponema pallidum
WP_010725189 171 VEDLKNRYLRTIGDPFLRFKQDPVRMLRLLKILSRYAFTVDPKTLEALQESCHELVKSSQPRVFEEIIKVLSSGESTIFF 250 Chlamydia trach...
WP_011071162 274 DMMQEYKLFAPLFPQVDALLKEAPKGPAMKMVQAIMKsTDDRVNEDKPVTPSFFYAAILWYPLRQRAEDIAVEsGLTLYD 353 Shewanella onei...
WP_010955347 259 EMLVDLELFEPLFPASAHALDERPTYTHTLISQALNN-TDLRVKQGKPVTPAFLFAALLWPALPARVLHLQNQ-GVPPIP 336 Pseudomonas putida
WP_002246109 249 KRLNGFDIPDDIHPLLN-ALRVSDGIAGKMTVLALKN-TDERLRADKSVSVGFVLAALMWPELERHWKSNLQQ-GLKPVP 325 Neisseria menin...
WP_010882042 236 RALCGYQLLLYLQPSVHYFMRDVPCFESAFFASLRVLdQAFVSGRVKRVGQALTYVLRDFVGLVFGHADAPDE--V--YI 311 Treponema pallidum
WP_010725189 251 QLASEHRVLEILFPYMAKAFSLS-KTLQDQTFACLTAlDTKIQKRSFCSERHFLLAILLFPIVNFNVRYKYSQyPTMTIQ 329 Chlamydia trach...
WP_011071162 354 AFFAAMGDVMEQQCQT--ISIPRRFSTPAKDIWQLQLRFERSQGTR-------AFKLLEHPKFRAAYDLLLLRgEVEGGN 424 Shewanella onei...
WP_010955347 337 AMNGAAHDLIAEQCAR--IAIPKRFTLPIREIWDMQERLPRRSGKR-------ADMLLDNPRFRAGYDFLLLR-ESAGEE 406 Pseudomonas putida
WP_002246109 326 ALSDAINTMRETVERG--WGVPQRFSATMREIWMFQPQFENRKGAR-------PHKLFAQARFRAAYDFLLLR-AETGNA 395 Neisseria menin...
WP_010882042 312 RVYRACRSFVLPMNPP-----------------RVELEYAVRS-------------CLGGRGFAARAACTPSG-RLCARE 360 Treponema pallidum
WP_010725189 330 SIFDYIRNFLTEFFADsfTSCSKKNFILTTLLLQMQYRLTPLNAMKkekksffNRRLLRHAYFREALYLLEIRsKVYPKV 409 Chlamydia trach...
WP_011071162 425 LAKSAAWWQQFVEADETERLTIAR---SGNKASGNRNRN 460 Shewanella oneidensis
WP_010955347 407 TDELGQWWTDYQDANDSERREMIRelgSRDESAGPRKRK 445 Pseudomonas putida
WP_002246109 396 DRALAEWWTAFQTASQEQRTEMTKn-eAAARHEKNEGQA 433 Neisseria meningitidis
WP_010882042 361 NGVRCVFSSP----------------------------- 370 Treponema pallidum
WP_010725189 410 EATYGEWLKHYELASE----------------------- 425 Chlamydia trachomatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap