Conserved Protein Domain Family
nqrF

?
TIGR01941: nqrF 
NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit
This model represents the NqrF subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130996
View PSSM: TIGR01941
Aligned: 6 rows
Threshold Bit Score: 719.656
Threshold Setting Gi: 15214181
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9Z723        10 ICIASLIFCAIGVILAGVILLSRKLFIKVHPCKLKINDNEELTKTVESGQTLLVSLLSSGIPIPSPCGGKATCKQCKVRV 89  Chlamydia pneum...
Q8ZBZ5         3 IILGVVMFTLIVLALTVMILFAKSKLVNTGDITVEINEDEDKSFTAPAGDKLLNMLSSHGIFVSSACGGGGSCGQCRVTI 82  Yersinia pestis
Q9HZL1         6 IFLAIGMFTAIVLGLVAIILVARAKLVSSGDVTIQING--EHSLTVPAGGKLLQTLAANNVFLSSACGGGGTCAQCKCVV 83  Pseudomonas aer...
WP_011071188   3 MAIGIGMFTLVVCLLVIVILIAKKKLVTTGEITIGINDDAEKSIKVAAGDKLLGALASKNIFIPSACGGGGTCGQCRVKV 82  Shewanella onei...
WP_011071352  14 VYLGVSMFTAIVLVLVLVILFAKSKLVSSGDITIGINDDPEKAITTGAGGKLLGVLANNGIFVSSACGGGGSCGQCRVVV 93  Shewanella onei...
WP_005874967   5 IIASAVVFLLLTLILVVALLYAKSKLVPSGNVTITVND--ERKMEVPLGGTLLNTLQNQGVFLSSACGGGGSCGQCRCRV 82  Porphyromonas g...
Q9Z723        90 VKNADEPLETDRSTFSKRQLEEGWRLSCQCKVQHDMSLEIEERYLNASSWEGTVISNDNVATFIKELVVAVDPNKPIPFK 169 Chlamydia pneum...
Q8ZBZ5        83 KEGGGDILPTELSHISKREAKEGCRLACQVNVKQNLKIELPEEIFGVKKWTCEVISNDNKATFIKELKLKIPDGDVVPFR 162 Yersinia pestis
Q9HZL1        84 VEGGGEMLPTEESHFTRRQAKEGWRLSCQTPVKQDMQIRVPEEVFGVKKWECTVESNPNVATFIKELTLRLPDGESVDFR 163 Pseudomonas aer...
WP_011071188  83 KSGGGDILPTELGHITKKEAKEGCRLACQVAVKTDMELELEEEIFGVKKWQCEVISNDNKATFIKELLLKLPEGEDVHFK 162 Shewanella onei...
WP_011071352  94 KSGGGDILPTELDHISKGDARKGCRLSCQVNVKNDMEIELDEEIFGIKKWECAVISNDNKATFIKELKLQIPDGESVPFR 173 Shewanella onei...
WP_005874967  83 VEGGGEILPTEKGFFSRKEQKDHWRLSCQTKVKEDLSIVIPEEVFGVKEWECEVLSNKNVSTFIKEFVVKLPEGETMNFK 162 Porphyromonas g...
Q9Z723       170 PGGYLQITVPSYKTNSSDWKqtMAPEYYSDWEHFHLFDQVIDNSqlpaDSANKAYSLASYPAELPTIKFNIRIATPPFIn 249 Chlamydia pneum...
Q8ZBZ5       163 AGGFIQIEAEPHTVKYADFD--VPTEYRGDWDKFNLFRFESVVT----EPTVRAYSMANYPEEHGIILLNVRIATPPPS- 235 Yersinia pestis
Q9HZL1       164 AGGYVQLECPPHVVEYKDFD--IQPEYRGDWDKFNMWRYVSKVD----ETVIRAYSMANYPEEKGVVKFNIRIASPPPG- 236 Pseudomonas aer...
WP_011071188 163 AGGYIQIEAPAHVVKYADFD--IPAKYRDDWEKYGLFDLVSTVN----EDVLRAYSMANYPDEKGRIMLNVRIATPPSA- 235 Shewanella onei...
WP_011071352 174 AGGYIQIEAPAHHVKYADFD--VPAKYRGDWEHFGFFKLESKVD----EETIRAYSMANYPEEFGIIMLNVRIATPPPR- 246 Shewanella onei...
WP_005874967 163 SGSYAQIKIPKYNIRYADYD--IQDRFRGDWDKMDAWSLTCKNE----EETVRAYSMANYPAEGNIITLNVRIATPPFDr 236 Porphyromonas g...
Q9Z723       250 g--kpNSEIPWGVCSSYVFSLKPGDKITVSGPYGESFMKDDDRPLIFLIGGAGSSFGRSHILDLLLNKHSKREIDLWYGA 327 Chlamydia pneum...
Q8ZBZ5       236 -----VPDAPPGIMSSYIWSLKPGDKVVISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLHSKRKISFWYGA 310 Yersinia pestis
Q9HZL1       237 -----S-DLPPGQMSSWVFNLKPGDKVTVYGPFGEFFAKDTEAEMVFIGGGAGMAPMRSHIFDQLRRLKSNRKISFWYGA 310 Pseudomonas aer...
WP_011071188 236 -----N--VPPGKMSSYIFNLKAGDKVTISGPFGEFFVKDTDAEMVFIGGGAGMAPMRSHIFDQLKSKKTKRKMSFWYGA 308 Shewanella onei...
WP_011071352 247 -----NLTLPCGKMSSYIWSLKAGDKVTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSFWYGA 321 Shewanella onei...
WP_005874967 237 aankwKAGIKPGISSSYIFSLKPGDKVMMSGPYGDFHIQDTDAEMLYIGGGAGMAPLRAQILHLFRTLKTGRKVSYWYGA 316 Porphyromonas g...
Q9Z723       328 RSLKENIYQEEYENLERQFPNFHYHLVLSEPLPEDIAAGwdkddptKTNFLFRAFNLGQLSRLDNPEDYLYYVCGPPLHN 407 Chlamydia pneum...
Q8ZBZ5       311 RSRREMFYEEDFDQLQAENDNFRWHVALSDPQPEDNWTG-------YTGFIHNVLLENYLKDHPAPEDCEFYMCGPPMMN 383 Yersinia pestis
Q9HZL1       311 RSLREAFYTEEYDQLQAENPNFQWHLALSDPQPEDNWTG-------LTGFIHNVLFENYLKDHPAPEDCEFYMCGPPMMN 383 Pseudomonas aer...
WP_011071188 309 RSTREVFYQQDFDTLAAENDNFVWHVALSEPLPEDNWTG-------YTGFIHNVLYENYLKNHKAPEDCEFYMCGPPIMN 381 Shewanella onei...
WP_011071352 322 RSKREMFYVEDFDGLAAENDNFVWHVALSDPQPEDNWDG-------YTGFIHNVLYENYLKNHDAPEDCEFYMCGPPMMN 394 Shewanella onei...
WP_005874967 317 RSKNEIFYEEDFREIEREFPNFKFHIALSDPQPEDNWTG-------YVGFIHQVIYDNYLKDHDAPEDIEYYMCGPGPMA 389 Porphyromonas g...
Q9Z723       408 SSILKLLGDYGVERSSIILDDFGS 431 Chlamydia pneumoniae
Q8ZBZ5       384 AAVIKMLKDLGVEDENIMLDDFGG 407 Yersinia pestis
Q9HZL1       384 AAVIKMLTDLGVERENILLDDFGG 407 Pseudomonas aeruginosa PAO1
WP_011071188 382 SSVIKMLESLGVEPENILLDDFGD 405 Shewanella oneidensis
WP_011071352 395 AAVIGMLKNLGVEDENILLDDFGG 418 Shewanella oneidensis
WP_005874967 390 NAVKGMLENLGVPRNMLFFDDFG- 412 Porphyromonas gingivalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap