Conserved Protein Domain Family
nqrE

?
TIGR01940: nqrE 
NADH:ubiquinone oxidoreductase, Na(+)-translocating, E subunit
This model represents the NqrE subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130995
View PSSM: TIGR01940
Aligned: 6 rows
Threshold Bit Score: 294.748
Threshold Setting Gi: 499258975
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q56589         2 EHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVYNLvLRENALVEG------VDL 75  Vibrio alginoly...
Q9K0M7         2 EHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVYSL-LKDGAIAEG------VDL 74  Neisseria menin...
Q9HZL0         2 EHYISLFVKAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIYTYlLKDGALAWAgl--peVDL 79  Pseudomonas aer...
Q9ZC45         3 ESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYiLRENALIDG------VDL 76  Yersinia pestis
Q9PKB3         9 INLLGIFLQATFIQNILLSTFLGMCSYLACSSRLSTANGLGMSVALVLTITGSINWLIHHFvTGPHALSWLspalanIDL 88  Chlamydia murid...
WP_010956515   1 MDYISMFVRSIFVDNMVFAYYLGMCSFLAVSKNVKTSIGLGAAVTFILVCTLPINYLLQNYiFKAGALSWLgsqyaeVDL 80  Porphyromonas g...
Q56589        76 SFLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYN-FAESIVYGFGSGVGWMLAI 154 Vibrio alginoly...
Q9K0M7        75 TFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYN-FGESVVYGFGAGLGWMLAI 153 Neisseria menin...
Q9HZL0        80 SFLGLLSYIGVIAAIVQILEMLLDKYVPSLYNALGVFLPLITVNCAIMAGSLFMVERDYN-LAESTVYGVGSGFSWALAI 158 Pseudomonas aer...
Q9ZC45        77 SFLDFITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYT-FTESFVYGTGCGLGWMLAI 155 Yersinia pestis
Q9PKB3        89 SFLELITFIVVIAAFTQILELLLERFSRNLYLALGIFLPLIAVNCAILGGVLFGITRNYP-FLPMVVFSLGSGCGWWLAI 167 Chlamydia murid...
WP_010956515  81 SFLSLIIFIAVIASFTQLVEMVVERFSPSLYASLGIFLPLIAVNCAILGGSLFMQQREFInVGMATVYGFGSGIGWMLAI 160 Porphyromonas g...
Q56589       155 VALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQ 197 Vibrio alginolyticus
Q9K0M7       154 VALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQ 196 Neisseria meningitidis MC58
Q9HZL0       159 AALAGIREKLKYSDVPEGLQGLGITFITIGLMSLGFMSFSGVQ 201 Pseudomonas aeruginosa PAO1
Q9ZC45       156 ISMAGLREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIR 198 Yersinia pestis
Q9PKB3       168 VLFATIREKLAYSDIPQHLQGMGISFITTGLIAMAFMGLTGID 210 Chlamydia muridarum str. Nigg
WP_010956515 161 VGMAAIREKLAYSNVPKPLRGLGITFIITGLMGIAFLSFSGVK 203 Porphyromonas gingivalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap