Conserved Protein Domain Family
nqrD

?
TIGR01939: nqrD 
NADH:ubiquinone oxidoreductase, Na(+)-translocating, D subunit
This model represents the NqrD subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130994
View PSSM: TIGR01939
Aligned: 6 rows
Threshold Bit Score: 293.563
Threshold Setting Gi: 15214094
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9Z8B4         2 TSKKSYKSYFFDPLWSNNQILIAILGICSALAVTTTVQTAITMGIAVSIVTGCSSFFVSLLRKFTPDSVRMITQLIIISL 81  Chlamydia pneum...
O84282         2 TTNKSYLTYFTDALWINNQPLIAILGICSALAVTTTVTTALTMGFAVSFVTGCSSFVVSLLRKITPESVRMIAQLIIISL 81  Chlamydia trach...
Q9HZK9         3 AAQPTIREVLFNPVFQNNPIGLQILGICSALAVTSNLKTATVMAIALTLVTGFSNLFISMIRRQIPSSIRMIVQMVIIAS 82  Pseudomonas aer...
P43958         2 SGKTSYKDLLLAPIAKNNPIALQILGICSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYIPNSIRIIVQLAIIAS 81  Haemophilus inf...
Q9RFV8         2 SSAQNIKKSIMAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVTFVTALSNFSVSLIRNHIPNSVRIIVQMAIIAS 81  Vibrio campbell...
WP_005874963   3 LWNKKNKEILLGPLSSNNPVIVQMLGICSALAVTAKLQPAIVMALSVTAVVAFANVIISLLRNTIPGRIRIIVQLVVVAA 82  Porphyromonas g...
Q9Z8B4        82 FVIVIDQFLKAFFFDISKTLSVFVGLIITNCIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIGVIRELFGFGTLM 161 Chlamydia pneum...
O84282        82 FVILIDQFLKAFFFTISKTLSVFVGLIITNCIVMGRAESMARHVSPIPAFLDGLGSGLGYGWVLVCISIIRELFGFGTIL 161 Chlamydia trach...
Q9HZK9        83 LVIVVDQVLKAYAYSLSKQLSVFVGLIITNCIVMGRAEAFAMANPPLVSFFDGIGNGLGYSAMLLVLGFVRELFGAGKLY 162 Pseudomonas aer...
P43958        82 LVIVVDQILKAYAYGLSKQLSVFVGLIITNCIVMGRAEAFAMKSPPVESFVDGIGNGLGYGSMLIIVAFFRELIGSGKLF 161 Haemophilus inf...
Q9RFV8        82 LVIVVDQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEAFAMKSAPVPSLIDGIGNGLGYGFVLITVGFFRELFGSGKLF 161 Vibrio campbell...
WP_005874963  83 LVTIVSQVLKAFAYDVNKQLSVFVGLIITNCILMGRLEAFALANRPWESFLDGIGNGLGYGWVLVIIAFFRELLGSGTLL 162 Porphyromonas g...
Q9Z8B4       162 GFRIIPqFVYASETHpdgYQNLSLMVLAPSAFFLLGIMIWLVNIRDSKKRK 212 Chlamydia pneumoniae
O84282       162 GFRVIPeILYTSAAHpdgYENLGLMVLAPSAFFLLGIMIWIVNIIRAPKTK 212 Chlamydia trachomatis D/UW-3/CX
Q9HZK9       163 GISVLP--TVNDGGW---YQPNGLLLLPPSAFFLIGLIIWALRTWKKDQVE 208 Pseudomonas aeruginosa PAO1
P43958       162 GMTIFE--TIQNGGW---YQANGLFLLAPSAFFIIGFVIWGLRTWKPEQQE 207 Haemophilus influenzae Rd KW20
Q9RFV8       162 GMEVLP--LVSNGGW---YQPNGLMLLAPSAFFLIGFLIWVIRILKPEQVE 207 Vibrio campbellii ATCC BAA-1116
WP_005874963 163 DIKVIP-KSFYESG----YVNNGLMILPPMALITVAVVIWVHRARNKDLQE 208 Porphyromonas gingivalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap