Conserved Protein Domain Family
nqrB

?
TIGR01937: nqrB 
NADH:ubiquinone oxidoreductase, Na(+)-translocating, B subunit
This model represents the NqrB subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130992
View PSSM: TIGR01937
Aligned: 6 rows
Threshold Bit Score: 589.449
Threshold Setting Gi: 499258976
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9Z8B6         2 LKKFINSLWKLCQQ-DKYQRFTPIVDAIDTFCYEPIETPSKPPFIRDSVDVKRWMMLVVIALFPATFVAIWNSGLQSIVY 80  Chlamydia pneum...
Q9PKB6         2 LEKFVDSLWKFCRK-SKFQYMTPVADAVDSFCFEPLHTPSSPPFVRDAVDVKRWMMLVVIALMPTVFVAIWNSGLQALVY 80  Chlamydia murid...
Q56587         3 LKKFLEDIEHHFEPgGKHEKWFALYEAVATVFYTPGIVTNKSSHVRDSVDLKRIMIMVWFAVFPAMFWGMYNAGGQAIAA 82  Vibrio alginoly...
O05011         3 LKNLFEKMEPAFLPgGKYSKLYPIFESIYTLLYTPGTVTHKNTHVRDALDSKRMMITVFLALFPAIFYGMYNVGNQAIPA 82  Haemophilus inf...
Q9HZK7         3 LRNLLDKVEHHFEKgGRYEKWYPLYEAVDTFLYRPGSVTRTTAHVRDGIDLKRMMIIVWLCTFPAMFFGMYNVGHQANLI 82  Pseudomonas aer...
WP_010956516   4 LRNQLNKLKPHFEEgGKLHGLHSVFDGFETFLFVPNRTSQHGVHVHDAIDSKRTMIVVCMALLPALLFGMYNVGVQHYMA 83  Porphyromonas g...
Q9Z8B6        81 SSGN------PVLMEQFLHISGFGSYLSFVYKEIHIVPILWEGLKIFIPLLTISYVVGGTCEVLFAVVRGHKIAEGLLVT 154 Chlamydia pneum...
Q9PKB6        81 QSSD------PQIMEAFLHISGFTSYFSFVSKEIGIASVLFAGCKIFLPLLFISYAVGGTCEVLFAIIRKHKIAEGLLVT 154 Chlamydia murid...
Q56587        83 LNHMyagdqlATVISGNWHYWLTEMLGGTIAADAGVGSKMLLGATYFLPIYATVFLVGGFWEVLFCMVRKHEVNEGFFVT 162 Vibrio alginoly...
O05011        83 LNQLgn---lDQLIANDWHYALASSLGLDLTANATWGSKMALGAIFFLPIYLVVFTVCTIWELLFSVVRGHEVNEGMFVS 159 Haemophilus inf...
Q9HZK7        83 FAQsp----dLLSAQDGWRFALIGALAG-FDPNSLWD-CLVQGAAYFLPVYLTTFIVGGFWEVLFASIRRHEVNEGFFVT 156 Pseudomonas aer...
WP_010956516  84 IDAP-----------------------------VVFWPAFLFGLLAVLPKLIVSYAVGLGIEFAVAQYRKEEIQEGFLVS 134 Porphyromonas g...
Q9Z8B6       155 GILYPLTLPPTIPYWMAALGIAFGIVVSKELFGGTGMNILNPALSGRAFLFFTFPAKMSGD-VWVGSNPgvikdslmkMN 233 Chlamydia pneum...
Q9PKB6       155 GMLYPLILPPTIPYWMAALGIAFGVVIGKELFGGTGMNILNPALTGRAFLFFTFPAKMSGD-VWVGSNPskikeslamMN 233 Chlamydia murid...
Q56587       163 SILFALIVPPTLPLWQAALGITFGVVVAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISGDvVWT--------------- 227 Vibrio alginoly...
O05011       160 TILFALIVPPTLPLWQAALGITFGIIVAKEIFGGVGRNFMNPALAGRAFLFFAYPAQISGDtVWT--------------- 224 Haemophilus inf...
Q9HZK7       157 SVLFALTLPPSVPLWQVALGISFGVVLGKEVFGGTGKNFLNPALVGRAFLFFAYPAQMSGDaVWT--------------- 221 Pseudomonas aer...
WP_010956516 135 GLLIPMIVPVDTPLWMIAVATAFAVVFAKEVFGGTGRNIFNVALVTRAFLFFAYPAAMSGDqVFVRTAD---------TF 205 Porphyromonas g...
Q9Z8B6       234 SSTGKVLIDGFSQSTCLQTLNSTPPSVKrlhvdaiaanmlhiphvptqdvihsqfslwtethpgwvldnltltqLQTFVT 313 Chlamydia pneum...
Q9PKB6       234 SLAERSNFDGFSQSTCLQILNSTPPSVKrvhidaiasnilklehvpsqevlqsqfstwaesfpgltvdqlsldqLQNFVT 313 Chlamydia murid...
Q56587       228 ------AADGFSGATALSQWAQGG-NGA----------------------------------------------LVNTVT 254 Vibrio alginoly...
O05011       225 ------AADGFSGATALSQWSQGG-QGA----------------------------------------------LQHTVT 251 Haemophilus inf...
Q9HZK7       222 ------SVDGFAGATSLSLAAAGG--------------------------------------------------VD-NIL 244 Pseudomonas aer...
WP_010956516 206 GLGAGTVADGFSGATPLGQIATAGAKMP----------------------------------------------EIHNVA 239 Porphyromonas g...
Q9Z8B6       314 APVAegglgllptqfdsayaitdviygigkfSAGNLFWGNIIGSLGETSTFACLLGAIFLIVTGIASWRTMAAFGIGAFL 393 Chlamydia pneum...
Q9PKB6       314 SPTAegglgllpahfdaaysltdaiygigkfSTGNLFFGNIVGSLGETSTVACLLGAGLLLLTGIASWRTMLSFGLSSLF 393 Chlamydia murid...
Q56587       255 GSPI---------------------------TWMDAFIGNIPGSIGEVSTLALMIGAAMIVYMRIASWRIIAGVMIGMIA 307 Vibrio alginoly...
O05011       252 GAPI---------------------------TWMDAFVGNLPGSMGEVSTLAILIGGAVIVFTRIAAWRIIAGVMIGMIA 304 Haemophilus inf...
Q9HZK7       245 GHGL---------------------------TWMDAFLGHMQGSMGETSTLAIFIGGAVLLLTRIASWRIVAGVMLGMVA 297 Pseudomonas aer...
WP_010956516 240 GDPS---------------------------SLMDAFLGFIPGSIGETSTLAILIGAVLLIWTGIASWKIMLSGLVGASA 292 Porphyromonas g...
Q9Z8B6       394 TGWLFKFIsvlivgqnGAWAPARFFIPAYRQLFLGGLAFGLVFMATDPVSSPTMKLGKWIYGFFIGFMTIVIRLINPAYP 473 Chlamydia pneum...
Q9PKB6       394 FAWLFKIIsilaagqsGAWAPAKFFIPVYRHLFIGGLAFGLVFMATDPVTSPATKLAKWFYGAFIGFLTILIRLINPAYP 473 Chlamydia murid...
Q56587       308 VSTLFNVI--------GSDTNPMFNMPWHWHLVLGGFAFGMFFMATDPVSASFTNKGKWWYGILIGAMCVMIRVVNPAYP 379 Vibrio alginoly...
O05011       305 TSTLFNLI--------GSETNPMFSMPWHWHFVLGGFALGMVFMATDPVSASFTNTGKWWYGALIGVMAVLIRTVNPAYP 376 Haemophilus inf...
Q9HZK7       298 MSYLFNAI--------GSASNPMFAMPWYWHLVTGGFAFGMIFMATDPVSASMTDTGKWLFGALIGVMVMLIRVVNPAFP 369 Pseudomonas aer...
WP_010956516 293 MALVFNAI--------GTT--AAMQITPLMHIVYGGFAFGLVFMATDPVTSARTEKGKWIFGFFVGLMAVFIRVLNPGYP 362 Porphyromonas g...
Q9Z8B6       474 EGVMLAILLGNVFAPLIDYFAVRKYRKRG 502 Chlamydia pneumoniae
Q9PKB6       474 EGVMLAILLGNVFAPSFDRIALKQYRQRR 502 Chlamydia muridarum str. Nigg
Q56587       380 EGMMLAILFANLFAPLFDHVVIEKNIKRR 408 Vibrio alginolyticus
O05011       377 EGMMLAILFANLFAPIFDYIVVQANIKRR 405 Haemophilus influenzae Rd KW20
Q9HZK7       370 EGMMLAILFANLFAPLIDHFVVQANIKRR 398 Pseudomonas aeruginosa PAO1
WP_010956516 363 EGMMLAILLMNVFAPLIDYFVVDSNIKAR 391 Porphyromonas gingivalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap