Conserved Protein Domain Family
NOT-MenG

?
TIGR01935: NOT-MenG 
RraA famliy
The E. coli member of this family has been characterized as a regulator of RNase E and its crystal structure has been analyzed. This model was initially classified as a "hypothetical equivalog" expressing the tentative hypothesis that all members might have the same function as the E. coli enzyme. Considering the second clade of enterobacterial sequences within this family, that appears to be less tenable. The function of these sequences outside of the narrow RraA equivalog model (TIGR02998) remains obscure. All of these were initially annotated as MenG, AKA S-adenosylmethionine: 2-demethylmenaquinone methyltransferase (EC 2.1.-.-). See the references characterizing this as a case of transitive annotation error in the case of the E. coli protein. [Unknown function, General]
Statistics
?
PSSM-Id: 130990
View PSSM: TIGR01935
Aligned: 9 rows
Threshold Bit Score: 237.229
Threshold Setting Gi: 17368389
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P96224           8 TADLVDDIGPDVR-----SCDLQFRQFGGRSQFAGPISTVRCFQDNALLKSVLSQPSAGGVLVIDGAGSLHTALVGDVIA 82  Mycobacterium...
CMCP6:VV1_0547   5 TPDICDQHEDKVT-----LLNLPLQNFGQKAAFFGEIVTVRCYHDNSKVRDVLSENGKGKVLVVDGHGSCQKALLGDQLA 79  Vibrio vulnif...
Q9S4U0           6 TPDLCDAYPELVQ-----VVEPMFSNFGGRDSFGGEIVTIKCFEDNSLVKEQADQPGAGKVLVVDGGGSLRRALLGDMIA 80  Pseudomonas f...
Q9KNQ9           5 TSALCDIYLDQVD-----VVEPMFSNFGGCASFAGQITTIKCYEDNGLIRETLEQDGLGRILLIDGGGSLRRALIDAELA 79  Vibrio choler...
Q9RW10           7 TTDLSDAQPqa------qVAAPVLRDFGGRTRFQGAAVTLRISENNPLVRQTLQTPGAGRVLVVDGGGSLNCALLGGNLG 80  Deinococcus r...
Q9FFE0           6 TAEVCDANQELIRsgqlrALQPIFQIYGRRQIFSGPVVTVKVFEDNGLIRQFIEEKGNGRVLVVDGGGSQRCAILGGNPV 85  thale cress
EWC51984        15 TPDLCDRYPDAM------IAEPLFRHFGGRTAFAGPLATVRCFEDNSRVRELAATPGDGRVLVVDGQGSLKHALLGDQIA 88  Xanthomonas a...
WP_011072520     5 LPDLFDHYPSKLT-----LLPLAFRAFGGKRLFWGEVVTVKCFEDNSKVKEVLAQPGHGKVLIVDGGGSSRRALLGDLIA 79  Shewanella on...
WP_011001303     8 VTDLCDAHEDQLAsgavrVLAPVFRSFGARAAFAGPAATLKVFEDNGLVRAMLEQPGEGRVLVVDGGGSLRCALVGGNLA 87  Ralstonia sol...
P96224          83 ELARSTGWTGLIVHGAVRDAAALRGIDIGIKALGTNPRKSTKTGAGERDVEITLGGVTFVPGDIAYSDDDGIIVV 157 Mycobacterium tube...
CMCP6:VV1_0547  80 ILAIENDWEGVIVFGAVRDVAQMSQMELGIKALGTSPFKTEKRGAGEVNVTLTMHNQMVQPKDYIYADWNGILIS 154 Vibrio vulnificus ...
Q9S4U0          81 EKAAKNGWEGLVIYGCVRDVDVLAQTDLGVQALAPHPMKTDKRGIGDLNVVVTFASVTFRPGEYVYADNNGVIVS 155 Pseudomonas fluore...
Q9KNQ9          80 ALAEENEWEGIVVYGSVREVDELEEMSIGIQAIASIPVGATSQGIGEVDIPVNFGGVTFLPEDYLYADNTGIIIS 154 Vibrio cholerae O1...
Q9RW10          81 VFGVENGWEGVIIHGCVRDTAELRELDLGIRALAAHPRRSGKLEEGERDVPVTFAGVTIRPGDHVVADEDGWLVL 155 Deinococcus radiod...
Q9FFE0          86 VQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALASHPIKASKKGLGEQRVPVNIAGTRICDGEWLYADTDGILVS 160 thale cress
EWC51984        89 ANAVANGWAGVLIHGCVRDVEILATLPLGVLALAACPRRTERRDLGDVDVPVNFAGVPFVPGHWLYADANGVLVA 163 Xanthomonas axonop...
WP_011072520    80 QSAMDNGWQGVIINGYVRDAARLSSFNLGVYALGAMPMKTEKLDQGQINVPIELGCVTVKPGMMVYVDENGIAIS 154 Shewanella oneidensis
WP_011001303    88 KLAEDNGWEGVLVNGCVRDTRELAACNVGVHALAAHPRKSFKKNQGERDIGVQMPGAYIHPGEWIYGDEDGVLVS 162 Ralstonia solanace...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap