3C1L


Conserved Protein Domain Family
peroxid_rel

?
TIGR01926: peroxid_rel 
Click on image for an interactive view with Cn3D
uncharacterized peroxidase-related enzyme
This protein family with length of about 200 amino acids. One member, from Myxococcus xanthus, is a selenoprotein, with an otherwise conserved Cys replaced by Sec. This family is drawn narrowly enough to suggest that These proteins contain a domain described by TIGR00778, with a CxxCxxxHxxxxxxxG motif. Some members of that family are known to act as peroxidases or correlate with resistance to oxidative stress.
Statistics
?
PSSM-Id: 130981
View PSSM: TIGR01926
Aligned: 8 rows
Threshold Bit Score: 235.382
Threshold Setting Gi: 167013506
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C1L_A         7 SALDLAS-GELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLXLGESG--LSKLDREXIAVAVSSINHC 83  Mesorhizobium l...
WP_011002127  13 SRFPVPElADIPGDIRERILAVQEKTGFVPNVFLALAHRPDECRAFFAYHDALMLREAGs-LTKGEREMIVVATSAANQC 91  Ralstonia solan...
WP_010888400  37 SFLAVPTeDNAHEGVKKLWSKAEANMGFVPNVFRAQALNGEQFLAWWNYFNLLVNKEGG--LSNAERELLAVVVSGLNRC 114 Deinococcus rad...
WP_010974674  17 PYVKPVDlATATPEQLSALKVTPSNTK-VSAYVLVLANEAEALNERTPLFNDIMYSDGG--LSRGGREIGALAASFVNHC 93  Agrobacterium f...
WP_010912186   6 SALDLAS-GELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLMLGESG--LSKLDREMIAVAVSSINHC 82  Mesorhizobium loti
WP_011001825  19 AWLDVVDlDRATPGQIAVLEESHPKAK-TSDYYRFLVHQPEILRQRSAAFNAIMYAPGG--LSRAERELASTVVSRVNGC 95  Ralstonia solan...
WP_011015117 233 PWVPPVAkADLTEEQLDSL--IQPERA-DMPYFRLLARDPAALKARTLTDLDIFFNTDGegLGRAERELGATVTSRYNGC 309 Corynebacterium...
WP_012655000  25 SRLRVPTeDELPQKLRDIHMRIRKKFGFVPNFLTALSANPGTALRIMAFYEHLFDQSNSh-LSASERELIAVVTSVATGC 103 Agrobacterium t...
3C1L_A        84 YYCLTAHGAAVRQLSGDPALGEXLVXNFRAADLSPRQTAXLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIASTAA 163 Mesorhizobium l...
WP_011002127  92 LYCVIAHGAILRIYEKQPLIADQVAVNYRKADITPRQRAMLDFAMQVCTASHTVNEADYDALHVHGFTDEDVWDIAGITA 171 Ralstonia solan...
WP_010888400 115 VYCAVSHGAALREFSGDAVKADAVAVNWRQAELSEREQAMCAYAEKLTLRPAEMTEADLAPLRAAGLSDEAILEAVQVIA 194 Deinococcus rad...
WP_010974674  94 IYCAAVHANRYIQLEKRPEVVDAIYKNGLDADLPDFEQALFNFGVDLTAHPDNVGVYQFYHLREIGLDDLEILDLIHSIA 173 Agrobacterium f...
WP_010912186  83 YYCLTAHGAAVRQLSGDPALGEMLVMNFRAADLSPRQTAMLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIASTAA 162 Mesorhizobium loti
WP_011001825  96 VYCAAVHAQRFEQLAKRNDVIRQVFEDPHTAGTNARERAIARFSIDLTLRPGDVRAEDLQPLQAAGLTDAEILDLIHAVA 175 Ralstonia solan...
WP_011015117 310 VYCASVHAGRAQEESGRADDVNALLASIDSDLGSDQWNVIRDAARALSSTPAAFNQGCITKLRGVGFSDLQIVDLINSVA 389 Corynebacterium...
WP_012655000 104 SYCVFNHRPALAAALGDRVLADRIARNHNDVTLAPRERALADLAQKLAATPHSVGSDDFARLRAIGFSEPAILEVLEVSA 183 Agrobacterium t...
3C1L_A       164 FFNXSNRVAAAIDXRPNDE 182 Mesorhizobium loti MAFF303099
WP_011002127 172 FFGLSNRIANVISMRPNDE 190 Ralstonia solanacearum
WP_010888400 195 MFNMTNRVSSALGFVPNPE 213 Deinococcus radiodurans
WP_010974674 174 IFGWANRLMHTLGEPHRKE 192 Agrobacterium fabrum
WP_010912186 163 FFNMSNRVAAAIDMRPNDE 181 Mesorhizobium loti
WP_011001825 176 IFAWANRLMLNLGEPVFPD 194 Ralstonia solanacearum
WP_011015117 390 FFNWANRLMLSLGEPEVPK 408 Corynebacterium glutamicum
WP_012655000 184 FFSYGNRLTIALNVLPDPQ 202 Agrobacterium tumefaciens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap