Conserved Protein Domain Family
spIIAB

?
TIGR01925: spIIAB 
anti-sigma F factor
This model describes the SpoIIAB anti-sigma F factor. Sigma F regulates spore development in B subtilis. SpoIIAB binds to sigma F, preventing formation of the transcription complex at the promoter. SpoIIAA (anti-anti-sigma F factor) binds to SpoIIAB to inhibit association with sigma F, however SpoIIAB can phosphorylate SpoIIAA, causing disassociation of the SpoIIAA/B complex. The SpoIIE phosphatase dephosphorylates SpoIIAA. [Regulatory functions, Protein interactions, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 130980
View PSSM: TIGR01925
Aligned: 3 rows
Threshold Bit Score: 222.106
Threshold Setting Gi: 499268211
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P10728         1 MKNEMHLEFSALSQNESFARVTVASFIAQLDPTMDELTEIKTVVSEAVTNAIIHGYEENCEGKVYISVTLEDHVVYMTIR 80  Bacillus subtil...
WP_003451402   1 MDNKMRLEFLAKSENEGFARVSVSAFIAQLDPTIEELTDIKTAVSEAVTNAIIHGYECDESKVVIIEASICEDEISITVE 80  Clostridium per...
WP_010965604   2 LENKMELKFLAKSENESFARVTVASFASELDPTLEEIDDVKMAVSEAVTNAIIHGYE-NKGGVVTICAVIEDRELTIEVM 80  Clostridium ace...
P10728        81 DEGLGITDLEEARQPLFTTKPELERSGMGFTIMENFMDDVSIDSSPEMGTTIRLTKH 137 Bacillus subtilis subsp. subtilis str....
WP_003451402  81 DNGIGIENLEEAREPLYTSKPELERSGMGFTVMETFMDSLEVYSEKDKGTKIIMKKK 137 Clostridium perfringens
WP_010965604  81 DEGIGIENIEKAMEPLYTSRPDLERSGMGFTVMESFMDNIKVESEKGKGTKIIMKKK 137 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap