3IPL


Conserved Protein Domain Family
menE

?
TIGR01923: menE 
Click on image for an interactive view with Cn3D
O-succinylbenzoate-CoA ligase
This model represents an enzyme, O-succinylbenzoate-CoA ligase, which is involved in the fourth step of the menaquinone biosynthesis pathway. O-succinylbenzoate-CoA ligase, together with menB - naphtoate synthase, take 2-succinylbenzoate and convert it into 1,4-di-hydroxy-2- naphtoate. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 162605
View PSSM: TIGR01923
Aligned: 7 rows
Threshold Bit Score: 607.524
Threshold Setting Gi: 447096267
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3IPL_A        28 TYQNLYCEASLLAKRLKAY---QQSRVGLYIDNSIQSIILIHACWLANIEIAMINT----RLTPNEMTNQMRSIDVQLIF 100 Staphylococcus ...
P23971        30 TFAELFAASKRMAEQLAAHsvrKGDTAAILLQNRAEMVYAVHACFLLGVKAVLLNT----KLSTHERLFQLEDSGSGFLL 105 Bacillus subtil...
Q53634        26 TYQNLYCEASLLAKRLKAY---QQSRVGLYIDNSIQSIILIHACWLANIEIAMINT----RLTPNEMTNQMKSIDVQLIF 98  Staphylococcus ...
WP_010945146  40 SWADFHQTILKTAEYFHVQgitSTKLIAYSGQSKFNGLLCYCTALAIGVPILMLNP----ALNEGQRQTILSDNQVEFLI 115 Haemophilus duc...
WP_010933507  25 SFADLDGDTARIATAFEASsirRGDIVALVAPNSPALVLSLMALMRMGAVAAPVNH----RFPANHIEGVLARLNPAMTL 100 Chlorobaculum t...
WP_010905533  25 INQEVNKMAEHLAPLID-----NQSRVALLSENSVEMAVVLFALLGLSKEVLLLNR----HLTEYELADQIKELKIDKVF 95  Lactococcus lactis
WP_001173523  32 TWQVLDSQVAHYAKALREQgvrSGEVVTLVGKNHLHTVLWFLACTQVGALCAFLAPqplaRLQEKLATLYAEQSPKHLXL 111 Vibrio cholerae
3IPL_A       101 CTLP-LE-LRG---FQIVSLDDIEFAGrdittnglldntmgiqYDTSnetvvpkespsniL-----NTSFNLDDIASIMF 170 Staphylococcus ...
P23971       106 TDSS-FEkKEYehiVQTIDVDELMKEAa---------------EEIE-------------I-----EAYMQMDATATLMY 151 Bacillus subtil...
Q53634        99 CTLP-LE-LRG---FQIVSLDDIEFAGrdittnslldntmgiqYETSnetvvpkespsniL-----NTSFNLDDIASIMF 168 Staphylococcus ...
WP_010945146 116 TDQL-F---KD---LLADILPQTTAYSl---------------SELN-------------I-----------DQPATLTL 149 Haemophilus duc...
WP_010933507 101 DAAK-LD-A-----FVADAIARTGATFt---------------AATE------------------------MERPVSVIH 134 Chlorobaculum t...
WP_010905533  96 TSDL-LT-EKV---TDSISFSEIWTSNp---------------CPVS-------------L-----SADFPDEKIAVIMN 137 Lactococcus lactis
WP_001173523 112 APSCaLS-EED---ITALNAHRLSLPDe---------------RDES-------------VggekvSSQFSGEQLATLIF 159 Vibrio cholerae
3IPL_A       171 TSGTTGPQKAVPQTFRNHYASAIGCKESLGFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKF--NaeQILTMIK 248 Staphylococcus ...
P23971       152 TSGTTGKPKGVQQTFGNHYFSAVSSALNLGITEQDRWLIALPLFHISGLSALFKSVIYGMTVVLHQRF--SvsDVLHSIN 229 Bacillus subtil...
Q53634       169 TSGTTGPQKAVPQTFRNHYASAIGCKESLGFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKF--NaeQILTMIK 246 Staphylococcus ...
WP_010945146 150 TSGSTGSPKAVVHSIRNHLENAVGVCQLMHFTQTDCWLLSLPLFHVSGQGIVWRWLLQGATLYLNDAK--A--QFFDCLA 225 Haemophilus duc...
WP_010933507 135 TSASSGKPKAAVHSLSNHYHSAMGSAQNLPFGPGDCWLLSLPLYHVGGYSMLFKCLLGGGALAVPSPD--A--ALAESLT 210 Chlorobaculum t...
WP_010905533 138 TSATTGKFKSVPITWGMISNHVKASKETLGAYDNDNWLVILPMFHVSGLSIIMRTLYNATSATVVDKFdeN--QLLEMIN 215 Lactococcus lactis
WP_001173523 160 TSGSTGTPKAVAHTHQQHLVSARGLLNKFAFTESDSWLLSLPLYHISGVAILYRWLAVGATLKIGTG------DLQNDIA 233 Vibrio cholerae
3IPL_A       249 NERITHISLVPQTLNWLMQQGLhEpYNLQKILL---GGAKLSATMIETALQYNLPIYNSFGMTETCSQFLTATPEMLHAR 325 Staphylococcus ...
P23971       230 RHEVTMISAVQTMLASLLEETNrCpESIRCILL---GGGPAPLPLLEECREKGFPVFQSYGMTETCSQIVTLSPEFSMEK 306 Bacillus subtil...
Q53634       247 NERITHISLVPQTLNWLMQQGLhEpYNLQKILL---GGAKLSATMIETALQYNLPIYNSFGMTETCSQFLTATPEMLHAR 323 Staphylococcus ...
WP_010945146 226 N--VSHASLVPTQLQRYLKERGtN-TLEQKFLL---GGSAIPATLIQQAQQQGITTYAGYGMTEMASTICAVENEIDN-- 297 Haemophilus duc...
WP_010933507 211 HFPVTHLSLVPTQLYRMLRADGgP-ERLRSLRAlllGGSAVSAPLLREAICERVPLYLTYGSTEMSTQVTTSPTPVTKAR 289 Chlorobaculum t...
WP_010905533 216 SGKINMVSLVPTLLTRIADKLHsN--NLRLILL---GGEFIPQPLIKKCQELGLPIYKTYGMTESFSQSVTFNILDFPDK 290 Lactococcus lactis
WP_001173523 234 G--VTHASLVPTQLKRLLDSSSp--LTLKRVLL---GGSHIPVELAQMAATRGIDTWLGYGMTEAASTVTAKRVDGLAG- 305 Vibrio cholerae
3IPL_A       326 P-DtVGMPSANVDVKIKNPnke----ghGELMIKGANVMNGYLY-PTDLTGTFEn-GYFNTGDIAEIDHEGYVMIYDRRK 398 Staphylococcus ...
P23971       307 L-GsAGKPLFSCEIKIERDgqvcepyehGEIMVKGPNVMKSYFN-RESANEASFqnGWLKTGDLGYLDNEGFLYVLDRRS 384 Bacillus subtil...
Q53634       324 P-DtVGMPSANVDVKIKNPnke----ghGELMIKGANVMNVYLY-PTDLTGTFEn-GYFNTGDIAEIDHEGYVMIYDRRK 396 Staphylococcus ...
WP_010945146 298 ----VGRPLAGRSIRI-VE---------NEIWVKGAGLALGYWQkNGEIQPLVNqqGWLQTKDCGKWNQQGQLVVKGRLD 363 Haemophilus duc...
WP_010933507 290 G-D-SGVVLPYREVAISVD---------GEILVKGECLFMGYLD-NGELREARDknGWFHTGDMGELSGDARLTVLGRKD 357 Chlorobaculum t...
WP_010905533 291 TsS-VGRPLPGVEIEIRQAdla----gvGEIWLKSPMLMKAYLG-QKPYGTAFE------TGDIGYLDTDGFLYLLNRRK 358 Lactococcus lactis
WP_001173523 306 ----NGELLEHRELRL-VD---------GRIFIAGKTLAQGYYR-QGQLVPLTNeqGWFDSKDLGRWQG-NNLLIDGRAD 369 Vibrio cholerae
3IPL_A       399 DLIISGGENIYPYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFVSES---D-ISKAQLIAYLSKHLAKYKVPKHFEK 474 Staphylococcus ...
P23971       385 DLIISGGENIYPAEVESVLLSHPAVAEAGVSGAEDKKWGKVPHAYLVLHK---P-VSAGELTDYCKERLAKYKIPAKFFV 460 Bacillus subtil...
Q53634       397 DLIISGGENIYPYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFVSES---D-ISKAQLIAYLSQHLAKYKVPKHFEK 472 Staphylococcus ...
WP_010945146 364 NMFISGGENIQPEEIEQLIYQSSWVQQVFVLPKEDSEFGQRPVAIIQFNNgdfT-ENVTKLTAWLTDKLEKFKLPIAYYP 442 Haemophilus duc...
WP_010933507 358 NMFISGGENIHPEEIEKALTSIVGIEEAVVVPAPDAEYGMRPVAWIKARS---DsPDDATIIASLKSTIGKLKTPVAFHR 434 Chlorobaculum t...
WP_010905533 359 DIIISGGENIYPKEIEDLVYSLPEIKECALVAKPDAKWGQVPILFVSGN------ISQEKLENFLTEKLAKYKRPQSITF 432 Lactococcus lactis
WP_001173523 370 NLFISGGENVHCEEIEAVLNQHPHVQVAIVIPVQDSEFGARPVAVIRSEA---E-WCQAIGDTWCQGKLEKFKWPIMYCL 445 Vibrio cholerae
3IPL_A       475 VDTLPYTSTG--KLQRNKL 491 Staphylococcus aureus subsp. aureus N315
P23971       461 LDRLPRNASN--KLLRNQL 477 Bacillus subtilis subsp. subtilis str. 168
Q53634       473 VDTLPYTSTG--KLQRNKL 489 Staphylococcus aureus
WP_010945146 443 LNIQDYEQQGniKIARQQV 461 Haemophilus ducreyi
WP_010933507 435 IQEWQTIP-GsaKIDRSWy 452 Chlorobaculum tepidum
WP_010905533 433 MDELPKNASG--KILRKEL 449 Lactococcus lactis
WP_001173523 446 LP-DALLD-GgiKVSRAAV 462 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap