Conserved Protein Domain Family
various_sel_PB

?
TIGR01918: various_sel_PB 
selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family
This model represents selenoprotein B of glycine reductase, sarcosine reductase, betaine reductase, D-proline reductase, and perhaps others. This model is built in fragment mode to assist in recognizing fragmentary translations. All members are expected to contain an internal TGA codon, encoding selenocysteine, which may be misinterpreted as a stop codon.
Statistics
?
PSSM-Id: 130973
View PSSM: TIGR01918
Aligned: 3 rows
Threshold Bit Score: 799.127
Threshold Setting Gi: 3097061
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC14301   5 KVVHYLNQFFAGIGGEEKADTLPHIAESQPPISQQLQKLIEEDAEIVGVVVCGDSYFNENLEEAKAKVLEMIKSFNPDIL 84  [Clostridium] stick...
AAC43574   5 RVVHYINQFFAGIGGEEKADIAPFVAEELPPISQNLDKLLGEDAEVVATVVCGDSFFGENLETAQATVLEMVKGASPDLF 84  [Clostridium] litorale
CAA76651   3 KAILYLNQFFGQVGGEDKADYEPEIINGQVGAAMMLNGVLEG-AEVTHTIICGDNFMGTYKDEAVSRIMGFLEDKEFDIF 81  Eubacterium acidami...
CAC14301  85 IAGPAFNAGRYGMACGTVVKMVQDELNLKAFTAMYEENPGLDVFRKEVYVIPTSDSAAGMRKALPAVAKFATKLAKGEEI 164 [Clostridium] stick...
AAC43574  85 IAGPAFNAGRYGVAAGAITKAVQDTLGIPAVTGMYIENPGADMYKKSVYVMSTADSAAGMRKSLPALAKFALKYAKGEEI 164 [Clostridium] litorale
CAA76651  82 LAGPAFQAGRYGVACGEICKVVKEKYNVPVVTSMHVENPGVQMFKKDMYVMIGGNNAGRMRQDMSAMAKVANKIIAGEKI 161 Eubacterium acidami...
CAC14301 165 LSPQEDGYFARGVRVNAFVDER--GSMRAVKMLVKKLKGEEFETEYPMPVFDRVAPNPAVKDITKAKIALVTSGGIVPKH 242 [Clostridium] stick...
AAC43574 165 GSPAEEGYIERGIRVNGFKEDR--GAKRAVAMLVKKLKGEEFVTEYPMPVFDNVVPGRAIVNMSKAKIAIVTSGGIVPKG 242 [Clostridium] litorale
CAA76651 162 GPADEEGFFPRGKRHQHWREDGkpASERVVDMLLKKLSGEEFQTELPIPKSDRVEIAAPIKDLSKATIAVVTTGGIVPVD 241 Eubacterium acidami...
CAC14301 243 NPDHIESSSASKYGRYDISSFDKLSEADHETAHGGYDPTYANNEPDRVLPVDVLRDLEKEGKIGELFKYFYTTVGNGTSV 322 [Clostridium] stick...
AAC43574 243 NPDRIESSSASKYGKYDIDGVDDLTSEGWETAHGGHDPVYANEDADRVIPVDVLRDMEKEGVIGELHRYFYSTTGNGTAV 322 [Clostridium] litorale
CAA76651 242 NPDRIQSASATRWGMYDVTGLERLEGGVYKTIHAGFDPAAADADPNVIVPLDALRAYEKEGKIGKVHEYFYSTVGTGTTE 321 Eubacterium acidami...
CAC14301 323 ANSKQFAQEFSKELLENKVDAVILTSTUGTCTRCGATMVKEIERAGIPVVHMCTVVPISLTVGANRIIPTIAIPHPLGNP 402 [Clostridium] stick...
AAC43574 323 LSSKQFAKEFTQELMAAGVDAVILTSTUGTCTRCGATMVKEIERSGIPVVHICTVTPIALTVGANRIVPAIAIPHPLGDP 402 [Clostridium] litorale
CAA76651 322 AEAARMAKEIVVKLKQGGVDGVIMTSTXGTCTRCGATMVKEIERAGFPIVQMCNLIPVASTVGANKIVPTISIPYPLGDP 401 Eubacterium acidami...
CAC14301 403 ALDAAEEKQLRRKLVEKALKALETEVEDQTVFE 435 [Clostridium] sticklandii DSM 519
AAC43574 403 ALSPAEEKALRRKIVEKSLKALETEIEEQTVFE 435 [Clostridium] litorale
CAA76651 402 STSKEQQWKLRYHRVGTALDALTVDVQEQTIFK 434 Eubacterium acidaminophilum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap