Conserved Protein Domain Family

TIGR01917: gly_red_sel_B 
glycine reductase, selenoprotein B
Glycine reductase is a complex with two selenoprotein subunits, A and B. This model represents the glycine reductase selenoprotein B. Closely related to it, but excluded from this model, are selenoprotein B subunits of betaine reductase and sarcosine reductase. All contain selenocysteine incorporated during translation at a specific UGA codon.
PSSM-Id: 130972
Aligned: 2 rows
Threshold Bit Score: 893.243
Threshold Setting Gi: 14717791
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAC14301 405 DAAEEKQLRRKLVEKALKALETEVEDQTVFE 435 [Clostridium] sticklandii DSM 519
AAC43574 405 SPAEEKALRRKIVEKSLKALETEIEEQTVFE 435 [Clostridium] litorale
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap