Conserved Protein Domain Family
TatC-Arch

?
TIGR01912: TatC-Arch 
Twin arginine targeting (Tat) protein translocase TatC, Archaeal clade
This model represents the TatC translocase component of the Sec-independent protein translocation system. This system is responsible for translocation of folded proteins, often with bound cofactors across the periplasmic membrane. A related model (TIGR00945) represents the bacterial clade of this family. TatC is often found (in bacteria) in a gene cluster with the two other components of the system, TatA/E (TIGR01411) and TatB (TIGR01410). A model also exists for the Twin-arginine signal sequence (TIGR01409).
Statistics
?
PSSM-Id: 162597
View PSSM: TIGR01912
Aligned: 6 rows
Threshold Bit Score: 186.835
Threshold Setting Gi: 28410733
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD67119       2 TLLGHIAEFRSVLLISGLAILLCSVIGW------IFFDQIFAALREPIRTLLSRKRIAT-----LNFPVLSAAFELRIQV 70  Tropheryma whip...
WP_011008026  26 RVLIASLIVFLIMWLPAPLTGAGNPLTTvlfnvdLYRPFGYWLFYQSIEPIVTELNKTTriqivLIWGQVWNPLASVVYS 105 Pyrobaculum aer...
WP_010903685  23 SIGVLLSTAQDRLQHVFIAFVVG-LLAGi----fVMRLFIWPTLEADLLPANAEV----------IAQTPFEVILMQVKI 87  Halobacterium s...
WP_010901632   5 RALIAFFVFFLIFFTFKFEYVT--FLGHri---vILYPDPYDNAGAQFLRLSEYHVLPKdv--eLIALKPTDAMVADIYS 77  Thermoplasma ac...
WP_011023410   7 NLSVILLTLRKKLTVVAAVLFTGVVLSF------QFTGPLIERMKEDLLPEGAK----------LVYVSPLEVMMLKLKL 70  Methanosarcina ...
WP_010866826  35 KVAIAFAVASIIVPLIPVSIAP--YVPLl----tVFTKYFINSVVPSTIDVLGYHVEVR-----LIQTSPFAGLSLLIKT 103 Aeropyrum pernix
CAD67119      71 AFTIGVILASPVWLHQLFYFFLPALKRT-----ERIIAILFVAVNVPLFLFG-AFLAWRLFPNIVQIATEFASPE---D- 140 Tropheryma whip...
WP_011008026 106 SAYITALIVFPYFVYEMWKYIKPALYPH-----EERAVKKYLGGSLILFYLGnLFSIYVIFPAVFRFTANFATIL---Gl 177 Pyrobaculum aer...
WP_010903685  88 GLFAGVLAALPVLAYHAKRPLQDRDIVPpi-svTRWQLGGVLVIAAGLAALGvLYAYFAFFPLMFQFLAGNADTV---Gl 163 Halobacterium s...
WP_010901632  78 VMFLALLFSMPVIVMEAAKFISPGLKKR-----EIQTIRSLGIPAAALFAVGsLFGFWYVFPVLFRIFFYFDFAV---Gs 149 Thermoplasma ac...
WP_011023410  71 SFIIGLLLTLPFIAFYAYRAVSRRFSLRnpiqiGKSQFLLLSVAALVMFVIGaSYAYFFMLPLFLDYLYLNAAGS---Gv 147 Methanosarcina ...
WP_010866826 104 ALLMGLLVVSPLLAYELYAFIKPALYPH-----EDRFVRTLGPIAVGLFMFGaLIAFKVILPLGYAISFVTSVVLvgdKl 178 Aeropyrum pernix
CAD67119     141 TLIMDARLYYAFALKLLLVIGAAFVIPSFLVFLNILRVVSAKAIV-KMWRVIILVVIVFSAAVTPASDVVSMFLLAAPVI 219 Tropheryma whip...
WP_011008026 178 SQIVDISSVVNTWITLALMSGVIFETPVVMAILSEICVLNPYSVQ-EYRPVVYAAALILIAVITPDPTVVSTILLFIPFI 256 Pyrobaculum aer...
WP_010903685 164 SPKYSIVKWTEFILFLSLSFSLAAQLPLLMSGLSYSGIVAYETFR-DKWRYAIVAIATFGALFSP-PDPFTQILWATPLV 241 Halobacterium s...
WP_010901632 150 SPTMGIANYTSFFFIYIVSFGLSFEMPVIMVALTKLKIVPASFWL-RNWRYAVVGSLIFGLVFSPGVLGVSMMIMAIPMM 228 Thermoplasma ac...
WP_011023410 148 TATYSIFKFISFAAAGTALFGLIFELPIVLTFLTRNGFIQYSTLV-TYRKHIYIVFLVAGAIITP-PDVLSQVMVAVPMV 225 Methanosarcina ...
WP_010866826 179 VAFADVNNILQTSILVIVGVGLLYETPVLLYGAVRAGLVSPNILSgDKGRMVLLGLLALGAVISPDGTGLGMLVLTLPLF 258 Aeropyrum pernix
CAD67119     220 FLYGFACLICFGYEK 234 Tropheryma whipplei TW08/27
WP_011008026 257 LLFELGLVFSKRIFK 271 Pyrobaculum aerophilum
WP_010903685 242 LLYGLSLYVSKIVVT 256 Halobacterium salinarum
WP_010901632 229 ALYFVGAFIAKRVEK 243 Thermoplasma acidophilum
WP_011023410 226 IFFEVSMVVVRVLGV 240 Methanosarcina acetivorans
WP_010866826 259 AALKLAVWFGAKSRK 273 Aeropyrum pernix
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap