Conserved Protein Domain Family

TIGR01902: dapE-lys-deAc 
N-acetyl-ornithine/N-acetyl-lysine deacetylase
This clade of mainly archaeal and related bacterial species contains two characterized enzymes, an deacetylase with specificity for both N-acetyl-ornithine and N-acetyl-lysine from Thermus, which is found within a lysine biosynthesis operon, and a fusion protein with acetyl-glutamate kinase (an enzyme of ornithine biosynthesis) from Lactobacillus. It is possible that all of the sequences within this clade have dual specificity, or that a mix of specificities have evolved within this clade.
PSSM-Id: 130957
Aligned: 4 rows
Threshold Bit Score: 506.699
Threshold Setting Gi: 497676202
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
BAB79614     324 LDHTPYEHVEVAEFLKGIEVLRGALEALAQT 354 Thermus thermophilus
CAD63113     576 LDHTLQEEVPFADYHLGIQTLQEAIQTYLGK 606 Lactobacillus plantarum WCFS1
WP_010867567 296 LDHTPYERISLMEYLQSIDVLKNVLTKLKGK 326 Pyrococcus abyssi
WP_009990386 315 LEHTTQEKISLDEIYIGVKTYMLAIEELWQK 345 Sulfolobus solfataricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap