Conserved Protein Domain Family
AcOrn-deacetyl

?
TIGR01892: AcOrn-deacetyl 
acetylornithine deacetylase (ArgE)
This model represents a clade of acetylornithine deacetylases from proteobacteria. This enzyme is the final step of the "acetylated" ornithine biosynthesis pathway. The enzyme is closely related to dapE, succinyl-diaminopimelate desuccinylase, and outside of this clade annotation is very inaccurate as to which function should be ascribed to genes. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 130947
View PSSM: TIGR01892
Aligned: 4 rows
Threshold Bit Score: 556.742
Threshold Setting Gi: 3044087
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P23908        10 EIYRALIATPSISATeealdqSNADLITLLADWFKDLGFNVEVQPVPGTr--NKFNMLASIGq---gAGGLLLAGHTDTV 84  Escherichia col...
AAC82366      10 ATLTELVAMDTTSFR------PNVPLIDYAQARLEAAGFSAERQKFLDDagvEKVNLVAVKGgsgsgRAALALVGHSDCV 83  Myxococcus xanthus
WP_010967970   5 EILGKLVGFRSVVGL------PNNDVVSWIRGYLESHGIAVDVLPGPEG---DRSNIFATIGpk--eARGYIISGHMDVV 73  Sinorhizobium m...
WP_010921458  14 DILAKLVAFDTTSRR------SNLALIEWVEQYLAELNVPTRRVPNADG---TKSNLMAMIGpa--vEGGVVLSGHTDVV 82  Caulobacter vib...
P23908        85 PFDdGRWTrDPFTLTEHDGKLYGLGTADMKGFFAFILDALrdVDVTKLKKPLYILATADEETSMAGARYFAETTA---LR 161 Escherichia col...
AAC82366      84 PYD-AAWT-DALRLTEKDGRLYARGACDTKGFIACALHAA--LNAEQLKAPLMVVLTADEEVGLTGAKKLVEAGL---GR 156 Myxococcus xanthus
WP_010967970  74 PAAeTGWTsDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVpkLAAMPLRRPLHLALSYDEEAGCRGVPHMIARLPelcRQ 153 Sinorhizobium m...
WP_010921458  83 PVDgQPWStDPWTLTERDGRLYGRGTCDMKGFLALALAAApdLAQANLRKPVHLAFSYDEEVGCLGAPDMIDVIArevPR 162 Caulobacter vib...
P23908       162 PDCAIIGEPTSLQPVRAHKGHISNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKER-YHYEAFTVPYPTLN 240 Escherichia col...
AAC82366     157 ARHAIVGEPTRLIPVRANKGYCLAEVEVRGKEGHSAYPDSGASAIFRAGRFLQRLEHLALTVLRE-DLDEGFQPPFTTVN 235 Myxococcus xanthus
WP_010967970 154 PLGAIIGEPTGMRAIRAHKGKAAARLTVRGRSGHSSRPDQGLNAIHGVAGVLTQAVAEADRLVGG-PFEHVFEPPYSSLQ 232 Sinorhizobium m...
WP_010921458 163 PALVVVGEPTDMVAVRAHKGIASFKVTVTGREAHSSLTHLGVSANMVAIKLMAMLVGLSEKLEREaDPNSPFTPKGATLT 242 Caulobacter vib...
P23908       241 LGHIHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAp----VSERWPGRLTVDELHPPIPGYECPPNHQLVEV 316 Escherichia col...
AAC82366     236 VGVIQGGKAKNVIPGACRFVVEWRPIPGQPPERVSQLLETIRQe----LVRDEPAFEAQIRVVRTDRGVNTRADAEVVRF 311 Myxococcus xanthus
WP_010967970 233 IGTVKGGQAVNIIPDSCEVEFEARAISGVDPAELLAPVRKTAEa----L--TTLGFEVEWQELSAYPALSLEPDAPLAAL 306 Sinorhizobium m...
WP_010921458 243 IGQVNGGTAVNILARECVFIFDLRTPAGMDPVALLSDFFAMASaldaqIKAKAPEGGVKVERRSLTPAFAPEEDGVAEAF 322 Caulobacter vib...
P23908       317 VEKLLGA--KTEVVNYCTEAPFIQTL-CPTLVLGPGSINQAHQPDEYLETRFIKPTRELITQVI 377 Escherichia coli K-12
AAC82366     312 LAEASGN--APETVSFGTEAPQMTELgAEAVVFGPGDIRVAHQTGEYVPVEDLVRCEAVLARAV 373 Myxococcus xanthus
WP_010967970 307 LEELTGRe-ALPAVSYGTEAGLFQRAgIDAIICGPGDIGRAHKPDEYILIDELMACRAMVEALG 369 Sinorhizobium meliloti
WP_010921458 323 ARKLAGDngPARVVPYAAEAGQFQGAgFSTVICGPGSIDQAHQPNEYVEISQMQRGGAFMRRLV 386 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap