Conserved Protein Domain Family

TIGR01889: Staph_reg_Sar 
Click on image for an interactive view with Cn3D
staphylococcal accessory regulator family
This model represents a family of transcriptional regulatory proteins in Staphylococcus aureus and Staphylococcus epidermidis. Some members contain two tandem copies of this region. This family is related to the MarR transcriptional regulator family described by pfam01047. [Regulatory functions, DNA interactions]
PSSM-Id: 130944
Aligned: 13 rows
Threshold Bit Score: 82.3023
Threshold Setting Gi: 27316336
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1FZP_B        83 RNEHDERTVLILVNAQQRKKIESLLSRVNKRIT 115 Staphylococcus aureus
BAB43590     209 RSLADERIVLIKINKIQYNTIKSIFTDTSKILK 241 Staphylococcus aureus subsp. aureus N315
AAO05511     204 RSRDDERYIVLTLRKEKVNVIQSEIEECYNKLE 236 Staphylococcus epidermidis ATCC 12228
AAO05481      82 RSETDERQVYYFFDAKQKKLLDKMTGEIETISI 114 Staphylococcus epidermidis ATCC 12228
KFA42344     126 RCELDERRVIVTIKREKFSKVTMLIQACYNYLE 158 Staphylococcus aureus
EUP01700     103 RSTEDERKILIHMDDAQQDHAEQLLAQVNQLLa 135 Staphylococcus aureus M1503
WP_001790114  87 RDPHDSRNVIIVVSVKQHNYIKNLLSEININET 119 Staphylococcus aureus
WP_000032852  85 RDQRDQRKLTISINKMHIDKIEYMNNELSDYIE 117 Staphylococcus aureus
WP_001801252  92 RSKIDERNTYISISEEQREKIAERVTLFDQIIK 124 Staphylococcus aureus
WP_023487167  95 RNEADERRIFVSVTPIQRKKIACVINELDKIIK 127 Staphylococcus aureus
EJE56443     100 RSSKDERKIYIYLNNDDISKFNALFEDVEQFLN 132 Staphylococcus aureus subsp. aureus str. Newbould 305
WP_002503638  85 RPQDDERTVIIHFNDKQNSKKEDLLKFIDDSIK 117 Staphylococcus epidermidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap