1LFW


Conserved Protein Domain Family
dipeptidase

?
TIGR01886: dipeptidase 
Click on image for an interactive view with Cn3D
dipeptidase PepV
This model represents a small clade of dipeptidase enzymes which are members of the larger M25 subfamily of metalloproteases. Two characterized enzymes are included in the seed. One, from Lactococcus lactis has been shown to act on a wide range of dipeptides, but not larger peptides. The enzyme from Lactobacillus delbrueckii was originally characterized as a Xaa-His dipeptidase, specifically a carnosinase (beta-Ala-His) by complementation of an E. coli mutant. Further study, including the crystallization of the enzyme, has shown it to also be a non-specific dipeptidase. This group also includes enzymes from Streptococcus and Enterococcus. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 130941
View PSSM: TIGR01886
Aligned: 4 rows
Threshold Bit Score: 789.851
Threshold Setting Gi: 24987586
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LFW_A         2 DLNFKELAEAKKDAILKDLEELIAIDSSEDLENATEEYPVGKGPVDAMTKFLSFAKRDGFDTENFANYAGRVNFGAGD-- 79  Lactobacillus d...
AAC45369       3 TIDFKAEVEKRKDALMEDLFSLLRIDSAMDMEHADAENPFGPGPRKALDAFLKIAERDGYTTKNYDNYVGHFEYENGAna 82  Lactococcus lac...
WP_002371462   2 TIDWTKEVEARKDDLLEDLQNLLRINSERDDAQATPEAPFGPGPVAGLKHMLAYGERDGFTVKNVDNYAGHIEYGEGD-- 79  Enterococcus
P45494         2 DLNFKELAEAKKDAILKDLEELIAIDSSEDLENATEEYPVGKGPVDAMTKFLSFAKRDGFDTENFANYAGRVNFGAGD-- 79  Lactobacillus d...
1LFW_A        80 --KRLGIIGHMDVVPAGEGWTRDPFKMEIDeE-GRIYGRGSADDKGPSLTAYYGMLLLKEAGFKPKKKIDFVLGTNEETN 156 Lactobacillus d...
AAC45369      83 daEVLGIIGHLDVVPAGSGWDSNPFEPEIR-N-GNLYARGASDDKGPTVACYYALKILKELNLPLSKKIRFIVGTNEETG 160 Lactococcus lac...
WP_002371462  80 --ETLGIFGHMDVVPAGDGWETDPYEPVIK-D-GKIYARGASDDKGPSMAAYYAMKIIKELGLPVSKKIRFVVGSDEESG 155 Enterococcus
P45494        80 --KRLGIIGHMDVVPAGEGWTRDPFKMEID-EeGRIYGRGSADDKGPSLTAYYGMLLLKEAGFKPKKKIDFVLGTNEETN 156 Lactobacillus d...
1LFW_A       157 WVGIDYYLKHEPT--PDIVFSPDAEYPIINGEQGIFTLEFSFKNdD-TKGDYVLDKFKAGIATNVTPQVTRATISGp--- 230 Lactobacillus d...
AAC45369     161 WADMDYYFEHCELplPDFGFSPDAEFPIINGEKGNITEYLHFSG-K-NAGQVVLHSFKAGLAENMVPESATAVISG---- 234 Lactococcus lac...
WP_002371462 156 WGDMDYYFQHEEA--PDFGFSPDAEFPIINGEKGNVTIRLTFRG-G-NGADYKLESFKSGLRENMVPGTADAVVTAasad 231 Enterococcus
P45494       157 WVGIDYYLKHEPT--PDIVFSPDAEYPIINGEQGIFTLEFSFKN-DdTKGDYVLDKFKAGIATNVTPQVTRATISGp--- 230 Lactobacillus d...
1LFW_A       231 dLEAVKLAYESFLADKE---LDGSFEINDESADIVLIGQGAHASAPQVGKNSATFLALFLDQYAFAGRDKNFLHFLAEVE 307 Lactobacillus d...
AAC45369     235 -AKDLEAALEKFVAEHAsknLRFDLEEADGKATITLYGKSAHGAMPEKGINGATYLTLFLNQFDFADGAAAFIKVGAEKL 313 Lactococcus lac...
WP_002371462 232 eAASLAASFETFIKQEAk--ISGNAELSDKTVTFHVVGKGAHGASPQSGINAATFLATFLNDYSFAEGAYSFINTIAEFI 309 Enterococcus
P45494       231 dLEAVKLAYESFLADKE---LDGSFEINDESADIVLIGQGAHASAPQVGKNSATFLALFLDQYAFAGRDKNFLHFLAEVE 307 Lactobacillus d...
1LFW_A       308 HEDFYGKKLGIFHHDDLMGDLASSPSMFDYEHaGKAS--LLNNVRYPQGTDPDTMIKQVLDKFSgILDVTYNG-FEEPHY 384 Lactobacillus d...
AAC45369     314 LEDHEGEKLGTAFVDELMENTSMNAGVWSFDE-NGEGk-IALNFRFPQGNSPERMQEILAKLDG-VVEVELSKhLHTPHY 390 Lactococcus lac...
WP_002371462 310 HEDFYGEKLGVAFEDEKMGKLTMNAGIVNFDPeNPENslVTLNFRYPKGTSAEELQAKVQTTVGeTVTATQGDrNQEPHY 389 Enterococcus
P45494       308 HEDFYGKKLGIFHHDDLMGDLASSPSMFDYEHaGKAS--LLNNVRYPQGTDPDTMIKQVLDKFSgILDVTYNG-FEEPHY 384 Lactobacillus d...
1LFW_A       385 VPGSDPMVQTLLKVYEKQTGKPGHEVVIGGGTYGRLFERGVAFGAQPENGPMVMHAANEFMMLDDLILSIAIYAEAIYEL 464 Lactobacillus d...
AAC45369     391 VPMSDPLVSTLIDVYEKHTGLKGYETIIGGGTFGRLLERGVAYGAMFEGEPDSMHQANEMKPVENIYKAAVIYAEAIYEL 470 Lactococcus lac...
WP_002371462 390 VPVDDPLVATLLQVYEDHTGEKGQEQIIGGGTYGRLLKRGVAYGAMFPGYTDTMHQANEFMELDDLFRAAAIYADAIYRL 469 Enterococcus
P45494       385 VPGSDPMVQTLLKVYEKQTGKPGHEVVIGGGTYGRLFERGVAFGAQPENGPMVMHAANEFMMLDDLILSIAIYAEAIYEL 464 Lactobacillus d...
1LFW_A       465 TK 466 Lactobacillus delbrueckii subsp. lactis
AAC45369     471 AK 472 Lactococcus lactis subsp. cremoris MG1363
WP_002371462 470 AK 471 Enterococcus
P45494       465 TK 466 Lactobacillus delbrueckii subsp. lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap