Conserved Protein Domain Family
PepT-like

?
TIGR01883: PepT-like 
peptidase T-like protein
This model represents a clade of enzymes closely related to Peptidase T, an aminotripeptidase found in bacteria. This clade consists of gram positive bacteria of which several additionally contain a Peptidase T gene.
Statistics
?
PSSM-Id: 162579
View PSSM: TIGR01883
Aligned: 3 rows
Threshold Bit Score: 564.56
Threshold Setting Gi: 499300572
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P54542         6 RLLEEFLELVQIDSETKHEAEICKVLKRKFSDLGVDVKEDDTMDITgHGAGNLICTLKGT-KQtDTIYFTSHMDTVVPGN 84  Bacillus subtil...
WP_000052806   8 RLVDHFLQLIQIDSESGNEKKIAETLAEQLGELGFTVHKLPVPAEV-SNGFNLYARLEGT-LN-DSILFSCHMDTVKPGI 84  Vibrio cholerae
WP_010991522   4 NVKKYFTELIQIPSVSGKEKAVLTYIKKQITKLNIPYSLDE--------DNGLIARIPATaVKfPTIFFCGHVDTHPNAA 75  Listeria innocua
P54542        85 GVKPVVENGYVKTDGTTILGADDKAGLAAMFEAIKVLKEENIEHGTIEFIITVGEESGLIGAKALDRSMITASYGYALDS 164 Bacillus subtil...
WP_000052806  85 GIEPVIEDGIIRSKGNTILGGDDKSGIAAILEAVRVLRDSQQAHKTIEIAFTVHEEGGLKGSEHFDMSKVQAEKAIVLDT 164 Vibrio cholerae
WP_010991522  76 SPEFQVEDGIFTSLNGTSLGADDKAAVAAMLAAMDYFSTEETPHGEIEFIFTTKEELGMIGMRLFPEEKITAAYGYCLDA 155 Listeria innocua
P54542       165 DGKVGNIIVAAPTQAKVRAAIFGKTAHAGVEPEKGISAITIASKAISKMPLGRIDEETTANIGRFEGGTQTNIVCDEVHI 244 Bacillus subtil...
WP_000052806 165 GGPIGTIVRAAPGQQKIVALIKGKPAHAGLVPEDGISAIAVAADAITQMKLLRIDEETTANIGIVQGGQATNIVMPELKI 244 Vibrio cholerae
WP_010991522 156 PGEVGNYQLQANTLVAVDFTIASPDATQ-------MSPISVARMALHATRPGRIDRENRWEIQSFSGGVNDENQQDAQLE 228 Listeria innocua
P54542       245 LAEARSLVPEKMEAQVQKMKAAFEEAAADMGGRAEVEIEVMYPGFKYQDGDQVVEIAKKAAAKIGRPSELQTSGGGSDAN 324 Bacillus subtil...
WP_000052806 245 VAEARSLNDAKLEAQVQHMIETFERAAEKHGATVEIESTRAYNAFKLEEDNAHIQAIKASFETIGIEPKTKLSGGGSDAN 324 Vibrio cholerae
WP_010991522 229 VLFKSAASFRKALPHIQTIRERFNQTCEKYGATLAEDTRLIYEGYKIHPQHPLMNIFQKAAKKQALKTSEIFLEGGTDAN 308 Listeria innocua
P54542       325 VIAGHGIPTVNLAVGYEQIHTKNEKMPIEELVKTAEMVVAIIE 367 Bacillus subtilis subsp. subtilis str. 168
WP_000052806 325 NFNAKGLTTVNLSTGMAKVHTTEEYIAIADMVKIAEFVCAYTT 367 Vibrio cholerae
WP_010991522 309 VLNEKGVPTMLLSAGYVHAHSEKETISVEQLEKLTQLVIDLAE 351 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap