Conserved Protein Domain Family
peptidase-T

?
TIGR01882: peptidase-T 
peptidase T
This model represents a tripeptide aminopeptidase known as Peptidase T, which has a substrate preference for hydrophobic peptides. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 130937
View PSSM: TIGR01882
Aligned: 3 rows
Threshold Bit Score: 734.394
Threshold Setting Gi: 1709639
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P42020   2 KyEKLLPRFLEYVKVNTRSDENSTTTPSTQALVEFAH-KMGEDMKALGLKDVHYLEsNGYVIGTIPANTDKKVRKIGLLA 80  Lactococcus lactis su...
P55179   2 K-EEIIERFTTYVKVDTQSDESVDTCPSTPGQLTLGN-MLVDELKSIGMQDAAIDE-NGYVMATLPSNTEKDVPTIGFLA 78  Bacillus subtilis sub...
Q9L4G1   2 EyPNLLPRFLKYVKVNSRSDENSDRFPSTEREENFQKnVIMKDLEELGLSDIHYNQkAGSVIAEIPSNVDYDVPVMGFLA 81  Lactobacillus helveticus
P42020  81 HLDTA-DFNAEGVNPQILENYDGESVIQLGDTEFTLDPKDFPNLKNYKGQTLVHTDGTTLLGSDDKSGVAEIMTLADYLL 159 Lactococcus lactis su...
P55179  79 HVDTAtDFTGKNVNPQIIESYDGKDIVLNEQLQVTLSPDQFPELSGYKGHTLITTDGTTLLGADNKAGIAEIMTAMDYLI 158 Bacillus subtilis sub...
Q9L4G1  82 HSDTA-DFNSENVKPQIHKNYDGESKIQLGDSEFYLDPEVYPNLRKYKGQTIITASGDTLLGADDKCGISELMTFAEYLM 160 Lactobacillus helveticus
P42020 160 NiNPDFEHGEIRVGFGPDEEIGVGADKFDVADFDVDFAYTVDGGPLGELQYETFSAAGAVIEFQGKNVHPGTAKNMMVNA 239 Lactococcus lactis su...
P55179 159 K-HPEIKHGTIRVAFTPDEEIGRGPHKFDVKRFNASFAYTVDGGPLGELEYESFNAAAAKITIKGNNVHPGTAKGKMINS 237 Bacillus subtilis sub...
Q9L4G1 161 N-HPEVKHGKIRLAFTPDEEIGTGAEQFDVKDFGADFAFTVDGEAPGKLGDCTFSAAQFTLDIQGVNVHPAVAKGQMINA 239 Lactobacillus helveticus
P42020 240 LQLAIDYHNALPEFDRPEKTEGREGFFHLLKLDGTPEEARAQYIIRDHEEGKFNERKALMQEIADKMNAELGQNRVKPVI 319 Lactococcus lactis su...
P55179 238 AKIAMKLNSLLPADEAPEYTEGYEGFYHLLSIQGDVEETKLHYIIRDFDKENFQNRKETMKRAVEELQNEYGQDRILLDM 317 Bacillus subtilis sub...
Q9L4G1 240 VQVGIDFHNQLPEHDRPEHTDGREGFFHLLSFDGTVDHAHLAYIIRDFERDGLEERKNLVKSIVKKMNDEFGTERIKLQM 319 Lactobacillus helveticus
P42020 320 KDQYYNMAQIIEKDMSIIDIAKKAMENLDIAPIIEPIRGGTDGSKISFMGLPTPNLFAGGENMHGRFEFVSVQTMEKAVD 399 Lactococcus lactis su...
P55179 318 NDQYYNMREKIEPVIEIVNIAKQAMENLGIEPKISPIRGGTDGSQLSYMGLPTPNIFTGGENFHGKFEYISVDNMVKAVN 397 Bacillus subtilis sub...
Q9L4G1 320 NDQYYNMADELKKHMDIVDLARDAYKAEGLEVNEDPVRGGTDGSQLTYMGLPCPNIFAGEENMHGRYEYTVLESMYKTVD 399 Lactobacillus helveticus
P42020 400 TLLEIIRLNNEVA 412 Lactococcus lactis subsp. cremoris
P55179 398 VIVEIAKQFEAQA 410 Bacillus subtilis subsp. subtilis str. 168
Q9L4G1 400 VMIKMAELNAERA 412 Lactobacillus helveticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap