Conserved Protein Domain Family
ANFD

?
TIGR01861: ANFD 
nitrogenase iron-iron protein, alpha chain
This model represents the all-iron variant of the nitrogenase component I alpha chain. Molybdenum-iron and vanadium iron forms are also found. The complete complex contains two alpha chains, two beta chains and two delta chains. The component I associates with component II also known as the iron protein which serves to provide electrons for component I. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 130920
View PSSM: TIGR01861
Aligned: 3 rows
Threshold Bit Score: 1132.38
Threshold Setting Gi: 113854
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q07933         1 MPYHEFEVSKCIPERREHAVMKAAGEDLTSCLPKGYLNTIPGTISERGCAYCGAKHVIGTPMKDVIHISHGPNGCTYDTW 80  Rhodobacter cap...
P16266         1 MPHHEFECSKVIPERKKHAVIKGKGETLADALPQGYLNTIPGSISERGCAYCGAKHVIGTPMKDVIHISHGPVGCTYDTW 80  Azotobacter vin...
WP_011021232   1 MPYHTFECSECIPERAMHAVIKGPGEDLTSCLPLGYLNTIPGTISERGCAYCGAKHVIGAPMKDVIHVSHGPVGCTYDTW 80  Methanosarcina ...
Q07933        81 QTKRYISDNDNFQLKYTFATDVKEKHVVFGAEGLLKKSMHEAFDAFPNIKRMTVYQTCTTALIGDDVDAIAKEVMEERGD 160 Rhodobacter cap...
P16266        81 QTKRYISDNDNFQLKYTYATDVKEKHIVFGAEKLLKQNIIEAFKAFPQIKRMTIYQTCATALIGDDINAIAEEVMEEMPE 160 Azotobacter vin...
WP_011021232  81 HTKRYISDNDNFQLKYTFATDMKEKHVVFGAEKMLKQNIIDCFKAFPHIKRMTIYQTCASALIGDDIAAVAKKVMAEMPD 160 Methanosarcina ...
Q07933       161 VDVFVCNSPGFAGPSQSGGHHKINIAWLNQKVGTVEPDYLGEHVINYVGEYNIQGDQEVMIDYFNRMGIQVLSTFTGNGS 240 Rhodobacter cap...
P16266       161 VDIFVCNSPGFAGPSQSGGHHKINIAWINQKVGTVEPEITGDHVINYVGEYNIQGDQEVMVDYFKRMGIQVLSTFTGNGS 240 Azotobacter vin...
WP_011021232 161 VDIFVCNAPGFGGPSQSGGHHKINIAWIDQKVGTYEPEIKSKYVINYVGDYNIQGDAEIMVDYFQRMGIQVLSTFTGNGS 240 Methanosarcina ...
Q07933       241 YDSLRMMHRAHLNVLECARSAEYICDELRARYGIPRLDIDGFGFEPLANSLRKVALFFGIEDKAEAIIAEEYAKWKPQLD 320 Rhodobacter cap...
P16266       241 YDGLRAMHRAHLNVLECARSAEYICNELRVRYGIPRLDIDGFGFKPLADSLRKIGMFFGIEDRAKAIIDEEVARWKPELD 320 Azotobacter vin...
WP_011021232 241 YDDLRGMHLAHLNVLECARSAEYICNELRKRYGTPRLDIDGYGFEPLSASLMKVAMFFGLEKEAQAIIDEETARWRPELN 320 Methanosarcina ...
Q07933       321 WYKERLKGKKVCLWPGGSKLWHWAHAIEEEMGLKVVSVYTKFGHQGDMEKGVSRCGEGALAIDDPNELESVEAIEMLKPD 400 Rhodobacter cap...
P16266       321 WYKERLMGKKVCLWPGGSKLWHWAHVIEEEMGLKVVSVYIKFGHQGDMEKGIARCGEGTLAIDDPNELEGLEALEMLKPD 400 Azotobacter vin...
WP_011021232 321 WYAKRLKGKKICLWPGGSKLWHWAHVIEEEMGVKVVSVYSKFGHQGDFEKGVARCSEGALAIDDPNELEGLEAMEMLQPD 400 Methanosarcina ...
Q07933       401 IIFTGKRPGEFVKKHGVPYLNAHAYHNGPYKGFEGWVRFARDIYNAIYSPMRQLAALDISAPDAAITSG-FRTAKMNADL 479 Rhodobacter cap...
P16266       401 IILTGKRPGEVAKKVRVPYLNAHAYHNGPYKGFEGWVRFARDIYNAIYSPIHQLSGIDITKDNAPEWGNgFRTRQMLSDG 480 Azotobacter vin...
WP_011021232 401 CVLTGVRPGEVSKKMRIPYLNIHGYHNGPYKGYEGWVRLARDLYNAIYSPIHQLSGMDISKDEIPTDKG-FLTRQMISDV 479 Methanosarcina ...
Q07933       480 TVSDEVKFSEVLHEYTGKYDSIAEIRARNqpMPPSR 515 Rhodobacter capsulatus
P16266       481 NLSDAVRNSETLRQYTGGYDSVSKLRERE--YPAFE 514 Azotobacter vinelandii
WP_011021232 480 NIVDDRTTPSEERPYTGDWDIVTRLRGKT--YPKLE 513 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap