Conserved Protein Domain Family
VNFD

?
TIGR01860: VNFD 
nitrogenase vanadium-iron protein, alpha chain
This model represents the alpha chain of the vanadium-containing component of the vanadium-iron nitrogenase compound I. The complex also includes a second alpha chain, two beta chains and two delta chains. Compount I interacts with compound II also known as the iron-protein which transfers electrons to compound I where the catalysis occurs. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 130919
View PSSM: TIGR01860
Aligned: 3 rows
Threshold Bit Score: 1029.9
Threshold Setting Gi: 138886
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA52044       2 PLKLLKCDETIPEREKHVYIKEKGEDTTQFLPLSNIETIPGSLSERGCSYCGAKLVIGGVLKDTIQMIHGPIGCAYDTWH 81  Anabaena variab...
P16855         2 PMVLLECDKDIPERQKHIYLKAPNEDTREFLPIANAATIPGTLSERGCAFCGAKLVIGGVLKDTIQMIHGPLGCAYDTWH 81  Azotobacter vin...
WP_011021237   2 PLKLFCCDECIPERKNHVYIKEEGEDTTDFLPLSNIDTIAGSLSERGCSYCGAKLVIGGVIKDCIQMIHGPVGCAYDTWH 81  Methanosarcina ...
CAA52044      82 TKRYPSDNGNFQLKYVWSSDMKESHVVFGGEKQLGKSIREAFKEFPDIKRMIVYTTCATALIGDDIKAVVKSAQQELGDV 161 Anabaena variab...
P16855        82 TKRYPTDNGHFNMKYVWSTDMKESHVVFGGEKRLEKSMHEAFDEMPDIKRMIVYTTCPTALIGDDIKAVAKKVMKDRPDV 161 Azotobacter vin...
WP_011021237  82 TKRYPSDNDNFQLKYIWSSDTKEKHIVFGAEKQLKKAIMEAFQEFPAIKRMFVYTTCTTALIGDNPKAVCREVQEELEDV 161 Methanosarcina ...
CAA52044     162 DIFCVECPGFAGVSQSKGHHVLNIAWINEKVGTLEPEITSPYTINVIGDYNIQGDTFVLEKYMEKMGIQIIAHFTGNGTY 241 Anabaena variab...
P16855       162 DVFTVECPGFSGVSQSKGHHVLNIGWINEKVETMEKEITSEYTMNFIGDFNIQGDTQLLQTYWDRLGIQVVAHFTGNGTY 241 Azotobacter vin...
WP_011021237 162 DIFVVECPGFAGVSQSKGHHELNIGWMRDKIGTLEPEITSEYTINVIGDYNIQGDTYVLQKYLDKMGIQVIAHFTGNVTY 241 Methanosarcina ...
CAA52044     242 DSLRGMHRAQLNVTNCARSAGYIANELKKRYGIPRLDVDTWGFDYCQEALRKIGAFFGIEDRAEAVIAEEIAKYQEKMDW 321 Anabaena variab...
P16855       242 DDLRCMHQAQLNVVNCARSSGYIANELKKRYGIPRLDIDSWGFNYMAEGIRKICAFFGIEEKGEELIAEEYAKWKPKLDW 321 Azotobacter vin...
WP_011021237 242 DQLRCMHRAKLNVVNCARSAGYIANELKRVYDIPRMDVDTWGFEYVKVALRKIGAFFGLEDKAEEVIAEEVAKYEGKLDW 321 Methanosarcina ...
CAA52044     322 YKERLSGKKVCIWTGGPRLWHWTKALEDDLGMQVVSMSSKFGHQEDFEKVIARGQEGTIYIDDGNELEFFEVLEMIRPDV 401 Anabaena variab...
P16855       322 YKERLQGKKMAIWTGGPRLWHWTKSVEDDLGVQVVAMSSKFGHEEDFEKVIARGKEGTYYIDDGNELEFFEIIDLVKPDV 401 Azotobacter vin...
WP_011021237 322 YKERLKGKQICIWTGGPRLWHWTKALEDDLGMEVVAMSSKFGHQEDFEKVIARGRIGTIYIDDGNELEFFEVLDNIHADL 401 Methanosarcina ...
CAA52044     402 VLTGPRVGALVKKLHLPYVNGHGYHNGPYMGFEGAVNMARDLYNAIYSPLMQLAAIDVRDD 462 Anabaena variabilis
P16855       402 IFTGPRVGELVKKLHIPYVNGHGYHNGPYMGFEGFVNLARDMYNAVHNPLRHLAAVDIRDK 462 Azotobacter vinelandii
WP_011021237 402 IFTGPRVGDLVKKLHIPYINGHAYHNGPYMGFEGAVNMARDMYNAIYSPMWKLAGKDPRET 462 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap