1GVF


Conserved Protein Domain Family
tag_bisphos_ald

?
TIGR01858: tag_bisphos_ald 
Click on image for an interactive view with Cn3D
class II aldolase, tagatose bisphosphate family
This model describes tagatose-1,6-bisphosphate aldolases, and perhaps other closely related class II aldolases. This tetrameric, Zn2+-dependent enzyme is related to the class II fructose bisphosphate aldolase; fructose 1,6-bisphosphate and tagatose 1,6 bisphosphate differ only in chirality at C4.
Statistics
?
PSSM-Id: 130917
View PSSM: TIGR01858
Aligned: 5 rows
Threshold Bit Score: 529.815
Threshold Setting Gi: 499320506
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GVF_A         3 IISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLD 82  Escherichia coli
P37192         3 VVSTKQMLNNAQRGGYAVPAFNIHNLETMQVVVETAANLHAPVIIAGTPGTFTHAGTENLLALVSAMAKQYHHPLAIHLD 82  Escherichia col...
WP_002209888   3 LVSSREMLRQAQIGGYAIPAFNIHNLETIQAVVETAAEMASPVILAGTPSTFSYAGTEYLVQICQQAARHYRMPFALHLD 82  Yersinia pestis
P42908         3 IISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLD 82  Escherichia coli
WP_011010998   4 IKSTKDMLLRAQKGGYAIPAFNIHNLETFQVVVETAAELNSPVIIAGTPGTIDYAGPDYIVAMAEVASQKYDIPIAIHLD 83  Clostridium per...
1GVF_A        83 HHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGGVEDDMSVDAESAFLTDPQEAKR 162 Escherichia coli
P37192        83 HHTKFDDIAQKVRSGVRSVMIDASHLPFAQNISRVKEVVDFCHRFDVSVEAELGQLGGQEDDVQVNEADALYTNPAQARE 162 Escherichia col...
WP_002209888  83 HHESYDDITQKVAAGIKSIMIDGSHFNFEQNIALTRQVVEYCHRWDGTVEAELGRLGGQEDDLTVDEKDALYTDPGSAAH 162 Yersinia pestis
P42908        83 HHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGGVEDDMSVDAESAFLTDPQEAKR 162 Escherichia coli
WP_011010998  84 HFEDPKLIKSHIITGFKSCMIDASHLSFEDNVNMVKEVVDFAHRYDATVEAELGKLVGVEDDLVVDENEGAYTDPDAALE 163 Clostridium per...
1GVF_A       163 FVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGA 242 Escherichia coli
P37192       163 FAEATGIDSLAVAIGTAHGMYASAPALDFSRLENIRQWVNLPLVLHGASGLSTKDIQQTIKLGICKINVATELKNAFSQA 242 Escherichia col...
WP_002209888 163 FIQATGIDSLAIAIGTAHGMYKEAPSLDFDRLALIRRNTDIPLVLHGGSGIPDEDVRRCIELGISKVNVGTELKIAFSGA 242 Yersinia pestis
P42908       163 FVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGA 242 Escherichia coli
WP_011010998 164 FVERTGVDSLAIAIGTAHGLYKGTPKLDFDRLVKIREKVSVPLVLHGASDVPDELVKKAIELGICKVNVATDLKIPFSDA 243 Clostridium per...
1GVF_A       243 VKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRI 284 Escherichia coli
P37192       243 LKNYLTEHPEATDPRDYLQSAKSAMRDVVSKVIADCGCEGRA 284 Escherichia coli K-12
WP_002209888 243 LKAYFLENKGANDPRHYMVPAKAAMKKVIQDKINVCGSAGKR 284 Yersinia pestis
P42908       243 VKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRI 284 Escherichia coli
WP_011010998 244 VKDYFIANPKANDPRKYMTPGKEAMKKIVEHKILLCGSNGKA 285 Clostridium perfringens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap