Conserved Protein Domain Family
FGAM-synthase

?
TIGR01857: FGAM-synthase 
phosphoribosylformylglycinamidine synthase, clade II
This model represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis. This model represents a second clade of these enzymes found in Clostridia, Bifidobacteria and Streptococcus species. This enzyme performs the fourth step in IMP biosynthesis (the precursor of all purines) from PRPP. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 130916
View PSSM: TIGR01857
Aligned: 4 rows
Threshold Bit Score: 2201.56
Threshold Setting Gi: 499326319
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
nestle:BL1108    3 FRVYVEKKPGFDVEAQQLAGELRTILGLTGLKALRIVNRYDVEGISQ--ELFDQTVPTVFSEPQVDNVAYDLPDFAG-A- 78   Bifidobacter...
WP_003457110     5 RMVFVEKKAGFNVESQILLKDFKDNLGIEALEDVRVLNKYILGDMEE--EQYVRTVNTILSEAPVDRVYEENFEIGQdE- 81   Clostridium ...
WP_000361188     3 KRIFVEKKADFQVKSESLVRELQHNLGLSSLKSIRIVQVYDVFDLAE--DLFAPAEKHIFSEQVTDHVLDEVSVQADlAn 80   Streptococcu...
WP_011016811     8 LRFFVEKKKGFDLDAKRLEKQFREELGVN-VRDLRLINCYDIFNLNDnkEDIEKIKKMILSEPVTDTITTELDLKGK--- 83   Fusobacteriu...
nestle:BL1108   79 -KVFATEFLPGQFDQRADSAAECIQLIS-QGERPTVRSAKLYALEGDLTDADVDTIKHYVINPVEAREASLeTKETLKTQ 156  Bifidobacter...
WP_003457110    82 -IAFGVEYLPGQYDQRADSASECIMLLT-EEEKVPVKSSKVLILKGNLNQEEINKIKSYYINPVDSREVSP-LSKVLEEN 158  Clostridium ...
WP_000361188    81 yAFFAIESLPGQFDQRAASSQEALLLLG-SSSDVTVNTAQLYLVNKDIDATELEAVKNYLLNPVDSRFKDItTGIAKQEF 159  Streptococcu...
WP_011016811    84 -KYFAVEFLPGQFDQRADSALQCIDIVSsEKQNADILTSRIIILNNELSDEELNKIKKFYINPIEMREKDLsVLKKEEIL 162  Fusobacteriu...
nestle:BL1108  157 VPVPGKVETIAGFNEMDAEAGQKFIDERGLAMDLADLEFCQKYFSEESREPTITEIKVIDTYWSDHCRHTTFGTELDEVT 236  Bifidobacter...
WP_003457110   159 LEEPNEVEILNGFLGLNEEGLKNFHREKSLAMSLEDLKLIRDYFKSEDRNPTITEIKVIDTYWSDHCRHTTFETIIKDVY 238  Clostridium ...
WP_000361188   160 SESDKTIPKLTFFESYAAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVLDTYWSDHCRHTTFETELKHID 239  Streptococcu...
WP_011016811   163 FN--SEVITYDNFILFDDVDLEKIRTDLGLSMSFEDLKFIQGHYKEIGRNPTETEIKVLDTYWSDHCRHTTFETKINKVT 240  Fusobacteriu...
nestle:BL1108  237 IDD----ATVKAAFERYLAMRHELGRDA---KPVCLMDMGTIGAKWLKKNGVLTGLDESEEINACTVKVKVDVNGHD--- 306  Bifidobacter...
WP_003457110   239 IEEgkysEPIKKAYEDYKNSRAYVYGENlnnKEVKLMDLATIAMKELRKRGKLDDLDVSEEINACSINIEIETDKGT--- 315  Clostridium ...
WP_000361188   240 FSAskfqKQLQSTYDKYIAMREELGRSE---KPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVK--- 313  Streptococcu...
WP_011016811   241 FPDsefgKQMEKEFNDYLKLKEDVSKK----RDVSLMDMATIVAKYLKKEGKLDNLEVSEENNACSVYVDVEVEDFEgkk 316  Fusobacteriu...
nestle:BL1108  307 --EDWLFLFKNETHNHPTEIEPFGGAATCIGGCIRDPLSGRSYVYQAMRVTGAADPTVPVSETLEGKLPQRKLVTTAAAG 384  Bifidobacter...
WP_003457110   316 --EEYLLMFKNETHNHPTEIEPFGGAATCLGGAIRDPLSGRSYVYQAMRVTGSADPTVEICETLKGKLPQRKITLGAAHG 393  Clostridium ...
WP_000361188   314 --EPWLLMFKNETHNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHG 391  Streptococcu...
WP_011016811   317 aiEKWLLMFKNETHNHPTEIEPFGGASTCLGGAIRDPLSGRAYVYQAIRVTGSGNPLETVEETLKGKLFQKKITTGAASG 396  Fusobacteriu...
nestle:BL1108  385 YSSYGNQIGLATGQVDEIYHPGYVAKRMEVGAVVAATPADHVRRETPAPGDKIILLGGRTGRDGIGGATGSSKAHNVESL 464  Bifidobacter...
WP_003457110   394 YSSYGNQIGLATGQVSEIYHPNYAAKRMEVGAVIAATPKENVIRLEPSKGDIVILLGGRTGRDGIGGATGSSKEHTEESI 473  Clostridium ...
WP_000361188   392 YSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGATPKGNVVREKPEAGDVIILLGGKTGRDGVGGATGSSKVQTVESV 471  Streptococcu...
WP_011016811   397 YASYGNQIGIATSLVSEIYHDGYKAKRMEVGAVVAAAPVENVVRKSPVPTDSIIIIGGKTGRDGCGGATGSSKEHNDKSL 476  Fusobacteriu...
nestle:BL1108  465 ELDGAEVQKGNAPVERKLQRLFRRGDACRLIKRCNDFGAGGVSVAVGELADGLFVDLNTVPKKYEGLDGTELAISESQER 544  Bifidobacter...
WP_003457110   474 NQCGAEVQKGNAPTERKIQRLFRNKEVAQMIKRCNDFGAGGVSVAIGELCRGIDIDLNKVPKKYEGLDGTELAISESQER 553  Clostridium ...
WP_000361188   472 ETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDFGAGGVCVAIGELADGLEIDLNKVPLKYQGLNGTEIAISESQER 551  Streptococcu...
WP_011016811   477 LLCGAEVQKGNAPEERKIQRLFRNPNATKLIKKCNDFGAGGVSVAIGELADGVEVNLDLVPVKYEGLNGTELAISESQER 556  Fusobacteriu...
nestle:BL1108  545 MAVDVDAEDVDEFLAYAREENLEATVIATVTEDPRMVMTWNGDKIVNLSREFLASNGASKHQTVHVEEQ----QSYETPW 620  Bifidobacter...
WP_003457110   554 MAVVISSENADRFIKLSEEENLEATIVAEVTDTDRLRMNWKDKTIVDIKRSFLDTNGAKQEISLKVKSP----SVYPYEV 629  Clostridium ...
WP_000361188   552 MAVVVRPEDVDAFVAECNKENIDAVVVATVTEKPNLVMHWNGETIVDLERRFLDTNGVRVVVDAKVVDKdvklPEERQ-T 630  Streptococcu...
WP_011016811   557 MAVIVSKEDTEKFLKYVDEENLLGTVVGYVTDKNRLTLNWKGKAIVDISRDFLNTNGVQQNIDIEVRDYenenVFEKFKT 636  Fusobacteriu...
nestle:BL1108  621 GEGTLAERMNKLVTDINVASNKGLSERFDSTIGAGTVLMPFGGKRQLTPNMAMVAKLPVFG-ETTTASAMAWGFNPYIMS 699  Bifidobacter...
WP_003457110   630 KNFDVKEEWLKSLRNLNVCSQKGLIERFDSTIGGGTVLMPLGGKYQLTPAEGMAAKIPVLGgESKDASLMTYGFNPYLGV 709  Clostridium ...
WP_000361188   631 SAETLESDTLTVLSDLNHASQKGLQTIFDCSVGRSTVNHPLGGRYQLTPTEASVQKLPVQHgVTHTASVIAQGFNPYVAE 710  Streptococcu...
WP_011016811   637 SDSSLEKKWLHNIKKLNVVSQKGLVEMFDSSVGAGTILAPFGGKYQMTPTDVSIMKFPVLNkNTNTASAITWGFNPYISE 716  Fusobacteriu...
nestle:BL1108  700 KNQFTGAYLSVVESLAKLVAAGFEHEKAYLSFQEYFEKLRDEPERWGKPAAAVLGALMAQVDLGAGAIGGKDSMSGSFED 779  Bifidobacter...
WP_003457110   710 WSPFHMAFYSVIESVTKIAAMGGDYKKVRLTFQEYFEKLLRDEEKWGKPFAALLGAYKAQMDLGLPAIGGKDSMSGSFGE 789  Clostridium ...
WP_000361188   711 WSPYHGAAYAVIEATARLVAAGANWFKARFSYQEYFERMDKQAERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEE 790  Streptococcu...
WP_011016811   717 WSTYHGAIYAVVESLAKLVAAGVDYKTARLSFQEYFEKLGKDSYKWSKPFLALLGAMKVQKDFDVAAIGGKDSMSGTFND 796  Fusobacteriu...
nestle:BL1108  780 LDVPPTLISFAVAVGNMKRATSPEFKDADHRIVRIAPRYLA-DGlTPDKDALLEVFSVIEELTDFHDALAVSTPGYGATA 858  Bifidobacter...
WP_003457110   790 LNVPPTLVSFAVGLEKASRIISPEFKNIGSTLVLMKGEKLE-DG-TLEMEGFKNNLEKLYELIGEEKVVSAYSLKFGGVS 867  Clostridium ...
WP_000361188   791 LTVPPTLAAFGVTTADSRKVLSPEFKAVGENIYYIPGQALS-A--EIDFDLIKKNFAQFEAIQADHKVTSASAVKYGGVV 867  Streptococcu...
WP_011016811   797 ISVPPTLISFAVSTVNVTDVISTEFKKAKNKIYLVENKINEkDF-LFDSQELKENFHFILKNIKDKKIVSAMVVKIGGLA 875  Fusobacteriu...
nestle:BL1108  859 EALFKMTLGNRIGVTLNDSIAvDDLFTPAYGSFIVELAD------DaklpavSNLVEIGEIGTTTSEYVFKAAG--ETLD 930  Bifidobacter...
WP_003457110   868 EGITKMSLGNRIGAILNNISK-EELFGFNYGSLILEVKEgvnledE------FKGTNYKVIGSTIKDGVIKCEEydFEVS 940  Clostridium ...
WP_000361188   868 ESLALATFGNYIGAEVTLPEL-ETALTAQLGGFVFTSPE------E--------IAGVEKVGQTKADFTLTVNG--VKLD 930  Streptococcu...
WP_011016811   876 EVLSKMSFGNRLGFEINNKNV--DLFSLKPASILIETTE------E------LSYKNAIYLGEVTDKFEGKVNG--ENIN 939  Fusobacteriu...
nestle:BL1108  931 LDAVQEAWESGIESVFPyrSKGEDKGATVETIDFHA--------------PKKTVYVGSSVAKPHVVIPVFPGNNCEYDS 996  Bifidobacter...
WP_003457110   941 LEELEKAYEEKLEYVFK--SKTEDKEECVSDLINNDkdganildngqmhiEEKLKSKITRVEKPRVVIPVFPGTNCEYDC 1018 Clostridium ...
WP_000361188   931 GHKLDSAFQGTLEEVYP--TEFTQAKELEEVPAVAS--------------D-VVIKAKEKVEKPVVYIPVFPGTNSEYDS 993  Streptococcu...
WP_011016811   940 LEEVEATWLNKLKPIFP--YKLEEKIETYDIKNKIS--------------EKKIYKSSITIAKPRVVIAAFPGTNSEYDM 1003 Fusobacteriu...
nestle:BL1108  997 AAAFERAGADVTTLIVNNLTPAAVAESTQALVDEINKSQIVMIPGGFSGGDEPDGSAKFITAFFRAPAVTEAVRDLLKnR 1076 Bifidobacter...
WP_003457110  1019 RRAFEKEGAEVSEVIIRNLNKEALIDSINMLKKEIDKSQIIMLPGGFSAGDEPDGSAKFIATIFRNPKIKDSVMKLLNeR 1098 Clostridium ...
WP_000361188   994 AKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDKTNILFFAGGFSAADEPDGSAKFIVNILLNEKVRVAIDSFIA-R 1072 Streptococcu...
WP_011016811  1004 YNRFNENGGEAKITLLRNLTQKHLTESVDEMCKDLRNSQIFVLPGGFSAGDEPDGSGKFMAAVLQNPKLMNEIKAFLD-R 1082 Fusobacteriu...
nestle:BL1108 1077 DGLMLGICNGFQALVKLGLVPYGDIVPMTDACPTLTFNTIGRHQSRLVRTRVASDLSPWLSKTSVGDIHTVAISHGEGRF 1156 Bifidobacter...
WP_003457110  1099 DGLILGICNGFQALIKLGLLPYGKIIDIEEDMATLTYNNINRHMSSIVRTKITSKKSPWFNEVSLGEVHSIPISHGEGRF 1178 Clostridium ...
WP_000361188  1073 GGLIIGICNGFQALVKSGLLPYGNFEAANSTSPTLFYNDANQHVAKMVETRIANTNSPWLVGVQVGDIHAIPVSHGEGKF 1152 Streptococcu...
WP_011016811  1083 DGLILGVCNGFQALVKSGLLPYGEIGNVHENSPTLTFNKIGRHISQIVKTKIVTNNSPWLSSFEIGETFDIPVSHGEGRF 1162 Fusobacteriu...
nestle:BL1108 1157 VASDEVLAQLRANGQIATQYVDETGTPGMDLDVNPNGSLLAIEGITSPDGRVFGKMGHSERSGNGLYVNVPGNKYQPIFE 1236 Bifidobacter...
WP_003457110  1179 VAPEALIKELVENDQIATQYVDLEGNMAMNMPYNPNGSSLAIEGIISRDGRILGKMGHSERIGDNLYKNIPGEFDQKLFK 1258 Clostridium ...
WP_000361188  1153 VVTAEEFAELRDNGQIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQIIGKMGHSERYEDGLFQNIPGNKDQHLFA 1232 Streptococcu...
WP_011016811  1163 YASDGVLKQLFENGQIATQYVDFDLEATNEFRFNPNGSSFAIEGIISPDGKIFGKMGHSERYSKDTFKNIDGNKNQNLIL 1242 Fusobacteriu...
nestle:BL1108 1237 AGVEYF 1242 Bifidobacterium longum NCC2705
WP_003457110  1259 SGVDYF 1264 Clostridium perfringens
WP_000361188  1233 SAVKHF 1238 Streptococcus pneumoniae
WP_011016811  1243 NGIKYF 1248 Fusobacterium nucleatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap