Conserved Protein Domain Family
argC_other

?
TIGR01851: argC_other 
N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form
This model represents the less common of two related families of N-acetyl-gamma-glutamyl-phosphate reductase, an enzyme catalyzing the third step or Arg biosynthesis from Glu. The two families differ by phylogeny, similarity clustering, and gap architecture in a multiple sequence alignment. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 273833
Aligned: 4 rows
Threshold Bit Score: 532.88
Threshold Setting Gi: 499189186
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P54894         3 KPKIFIDGEAGTTGLQIYSRLNERDDIELVSIAASKRKDADERAKLLNSVDVAILCLPDDAAREAVSLVNSSQVKILDAS 82  Nostoc sp. PCC ...
WP_010919254   4 APKVFIDGEAGTTGLQIRERLVGRTDLQLISIDPDKRKDADARAEMLNSADAVILCLPDDAAKEAVSLVSNPNTVIIDAS 83  Caulobacter vib...
WP_011000109   2 AFKVFVDGQEGTTGLRLLDYLSQRDDIELLRIAEDRRKDPAERAKFLNAADVAFLCLPDVASREAVSLVDNPNTCIIDAS 81  Ralstonia solan...
WP_010886726   3 KPKIFIDGEAGTTGLQIRERLAGRSDLELLSIDPVRRKDSAARAELLNAADVSILCLHDDAAREAVSLTTNPASRLLDAS 82  Deinococcus rad...
WP_010919254   4 APKVFIDGEAGTTGLQIRERLVGRTDLQLISIDPDKRKDADARAEMLNSADAVILCLPDDAAKEAVSLVSNPNTVIIDAS 83  Caulobacter vib...
WP_011000109   2 AFKVFVDGQEGTTGLRLLDYLSQRDDIELLRIAEDRRKDPAERAKFLNAADVAFLCLPDVASREAVSLVDNPNTCIIDAS 81  Ralstonia solan...
WP_010886726   3 KPKIFIDGEAGTTGLQIRERLAGRSDLELLSIDPVRRKDSAARAELLNAADVSILCLHDDAAREAVSLTTNPASRLLDAS 82  Deinococcus rad...
P54894        83 TAYRTAQGWVYGFPEMNPGQREKIANAQFVSNPGCYPTGFLACVRPLIAQGILPSSFPITINAVSGYSGGGKSLIQKYDS 162 Nostoc sp. PCC ...
WP_010919254  84 TAYRTAEGWAYGFAELDSEQRGKIAASKRISNPGCYPTGAIALTRPLVSAGILPAELPVSYNAVSGYTGGGKAMIAQFED 163 Caulobacter vib...
WP_011000109  82 TAFRTSDDWAYGLPELAPGQRERLRNSKRIAVPGCHASAFVLLMRPLVEAGIVPADYPITAFSLTGYSGGGKKMIADYL- 160 Ralstonia solan...
WP_010886726  83 TAHRIHPDWVFGFPELSAEQPEKIRQARYVANPGCYSTGAIALLAPLTGRGLLPADFPVHIQGYSGYTGGGRALVDAHEQ 162 Deinococcus rad...
WP_010919254  84 TAYRTAEGWAYGFAELDSEQRGKIAASKRISNPGCYPTGAIALTRPLVSAGILPAELPVSYNAVSGYTGGGKAMIAQFED 163 Caulobacter vib...
WP_011000109  82 TAFRTSDDWAYGLPELAPGQRERLRNSKRIAVPGCHASAFVLLMRPLVEAGIVPADYPITAFSLTGYSGGGKKMIADYL- 160 Ralstonia solan...
WP_010886726  83 TAHRIHPDWVFGFPELSAEQPEKIRQARYVANPGCYSTGAIALLAPLTGRGLLPADFPVHIQGYSGYTGGGRALVDAHEQ 162 Deinococcus rad...
P54894       163 fheQQKGATSDYPFGIYGLQFGHKHVKEMHQHSGLASPPLFIPAVGDFEQGMLVQIPLPLWTLDNPPSGEEIHQAIAQYY 242 Nostoc sp. PCC ...
WP_010919254 164 ---ESAADHTRAPYFIYGLSLSHKHVPEMQKHGGLLTRPIFTPAVGRYAQGMIVEMPLHLSTLNGAPSLADIHAALVKHY 240 Caulobacter vib...
WP_011000109 161 ----AADNPKLQSPRPYALALTHKHLPEMRVQSKLALPPIFTPVVGNFLKGLAVTIGLHPQHLASKVSPADIAKVFADYY 236 Ralstonia solan...
WP_010886726 163 ---GSAH-PSKGAFISYGLTLEHKHLPETMVYGGLTRKPVFTPNVGGWAQGMTVTVPLHLAELG--VSAEALHAALKEHY 236 Deinococcus rad...
WP_010919254 164 ---ESAADHTRAPYFIYGLSLSHKHVPEMQKHGGLLTRPIFTPAVGRYAQGMIVEMPLHLSTLNGAPSLADIHAALVKHY 240 Caulobacter vib...
WP_011000109 161 ----AADNPKLQSPRPYALALTHKHLPEMRVQSKLALPPIFTPVVGNFLKGLAVTIGLHPQHLASKVSPADIAKVFADYY 236 Ralstonia solan...
WP_010886726 163 ---GSAH-PSKGAFISYGLTLEHKHLPETMVYGGLTRKPVFTPNVGGWAQGMTVTVPLHLAELG--VSAEALHAALKEHY 236 Deinococcus rad...
P54894       243 QGEKFVQVAPFKDPSLLrdgTFLDATAVNGTNIVQVFVFGNDNTKEALLVARLDNLGKGASGAAVQNLNIMLGL 316 Nostoc sp. PCC 7120
WP_010919254 241 KGEAFVEVASLDEAKAL---TTLDPEGLNGTNRLKLFVFGSDAGGQARLVALLDNLGKGASGAAVQNLNIALGL 311 Caulobacter vibrioides
WP_011000109 237 QGEQFIRVAPADNVETLd-nGFFDVQGANDTNRADLFVFGSD--ERMVVTARLDNLGKGAAGAAVQCMNVHLGV 307 Ralstonia solanacearum
WP_010886726 237 AGQQYVKVFELADNP-----EILDPQTLNGTNNLELFVYPAADGERALLAARLDNLGKGASGAAVQNLELMLGL 305 Deinococcus radiodurans
WP_010919254 241 KGEAFVEVASLDEAKAL---TTLDPEGLNGTNRLKLFVFGSDAGGQARLVALLDNLGKGASGAAVQNLNIALGL 311 Caulobacter vibrioides
WP_011000109 237 QGEQFIRVAPADNVETLd-nGFFDVQGANDTNRADLFVFGSD--ERMVVTARLDNLGKGAAGAAVQCMNVHLGV 307 Ralstonia solanacearum
WP_010886726 237 AGQQYVKVFELADNP-----EILDPQTLNGTNNLELFVYPAADGERALLAARLDNLGKGASGAAVQNLELMLGL 305 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap