Conserved Protein Domain Family
PHB_depoly_PhaZ

?
TIGR01849: PHB_depoly_PhaZ 
polyhydroxyalkanoate depolymerase, intracellular
This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some [Fatty acid and phospholipid metabolism, Degradation]
Statistics
?
PSSM-Id: 130908
View PSSM: TIGR01849
Aligned: 5 rows
Threshold Bit Score: 686.117
Threshold Setting Gi: 18076811
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC85536       6 SYDLMETIRNTNEWMGASARAMASYPVWG---LTPHPMFKLMSAWGRVTERsFARMVIKPDWGIRSIpAADGKDHLIEIE 82  Rhodobacter cap...
WP_003536442   2 FYQLYEMNHAMMAPWRTAADAMRLAFSNPmnpVSHTYFGRAAAAGLEVFER-ATRRYGKPEFGLPET-EIDGQPVPVRER 79  Sinorhizobium m...
WP_004599520  10 TYYILEWLRAQIAPMHLGIKILKELYEHEp--LEDNGFARIIHAYLTLCER-MTRKYTKPEFNILET-IINDKTYNINEQ 85  Rickettsia prow...
WP_024265522   2 LYALHEAAYYASTPMRLAALAARDFWGSPlnpAADSAVGRRMHAGADLFAN-VTRRYGKPKWNIDKV-KVGQVDVRVRPT 79  Caulobacter vib...
WP_015472356  14 LYQLHELTRNLLAPWVHQAQANAKMFSDPdslWASLPGAERMAASNELFHR-LGKEYEKPAWALDDV-EVDGHSLPIIER 91  Xanthomonas
CAC85536      83 TLIDKPFGALIHFKVQG-RAPMP------RRILLVAPMSGHYATLLRSTVASLLPDADVYVTDWHNARDIPVSAGKFDIE 155 Rhodobacter cap...
WP_003536442  80 IVWREPFCNLIHFERSLpRDRAPd-----PKVLIVAPMSGHYATLLRGTVEALLPHSDVYITDWIDARMVPLSEGTFDLD 154 Sinorhizobium m...
WP_004599520  86 VIFKKPFCELRHFQKIGfKKELP-------KLLIVAPMAGHHATLLRSTVHALLPYTDIYITDWTEANYVPLEAGHFDMD 158 Rickettsia prow...
WP_024265522  80 VVWESPWARLVQFDRDMaDMRRAgkfsldPAVLIVAPLSGHYATLLRGTVEAFLPDHAVFIVDWVNAREVSVLEGRFDFH 159 Caulobacter vib...
WP_015472356  92 EVLSKPFCRLLRFKRFSdHVELIgkmkeqPAVLVVAPLSGHHATLLRDTVRTLLRNHKVYVTDWVDARMVPLEAGAFRLE 171 Xanthomonas
CAC85536     156 DYTLYLVEFMRLLGPD-INVIAVCQPAPLTLAATAYLAEEEPEAQPRTLTLIGGPIDPDAAATEVTDFGRRVTMGQLEHM 234 Rhodobacter cap...
WP_003536442 155 DYIDYVIQMLHFLGPD-AHVIGVCQPAVPVLAAVALMEAAEDPLAPSTMTLMGGPIDTRINPTAVNELAKERPIEWFRDN 233 Sinorhizobium m...
WP_004599520 159 DYIDYLIEFINFMGQN-IHTMAVCQPTVPLLAAISLMSENNSPNVPSSMILIGGPIDARKNPTVVNEFALSKSLEWFCEM 237 Rickettsia prow...
WP_024265522 160 DYIDHVIQMLEVLGPR-PNVVAVCQPGPPVLAAAALMAEQNHPSRPASMTFMGSPIDARLSPTVTNQLAEEKPFTWFQSN 238 Caulobacter vib...
WP_015472356 172 DYITYIQEFIRHIGAErLHVVSVCQPTVPVLAAVSLMASNDEP-TPRSLVMMGGPIDARRSPTQVNNLATENGIEWFQNN 250 Xanthomonas
CAC85536     235 VIQRVGFKYKGAGRLVYPGLMQLASFISMNMDKHTKAFSDKILMESKGEGSEHDHHNIFYDEYLAVMDMTAEFYLSTVER 314 Rhodobacter cap...
WP_003536442 234 VVMPVPWPQPGFMRMVYPGFLQLSGFMSMNLDRHLIAHKEFFAHLVKNDGDAAEKHRDFYDEYLAVMDLTAEFYLQTVQV 313 Sinorhizobium m...
WP_004599520 238 LTMQVPPNYPGYGRKVYPGFLQLTGFISLNLLRHIDSHLELWQSLLNSDYQKADYIIKFYDEYLSGMDMPAEFYLQTIDE 317 Rickettsia prow...
WP_024265522 239 MIYNVPPPYAGAGRRVYPGFVQLASFMSMNADRHQEAHRRYFNHLVSGDGDSADKHLEFYDEYLSVLDLTEEFYLQTIDI 318 Caulobacter vib...
WP_015472356 251 LIHTVPFPYPGHGRQVYPGFLQHAGFLSMNPNRHVMSHWDFYTDLVKGDLQDAQAHRQFYDEYNAVLDMPAEYYLDTIRV 330 Xanthomonas
CAC85536     315 IFKGLEIAQNRFEVEGKRVDIGKITRVAVKTVEGANDDISAPGQCVAALRLCTGLPEDKKAQHLEPGAGHYGIFAGSSWR 394 Rhodobacter cap...
WP_003536442 314 VFMQHALPKGEMIHRGKRVDPTAIRRVALLTVEGENDDISGLGQTKAAQTICTGIPDSMRQHYMQPDVGHYGVFNGSRFR 393 Sinorhizobium m...
WP_004599520 318 VFQQFSLARGKFISEKRPIDLKHITKCALLGIEGELDDIAAVGQTKAALKLCVNISESMKRYHLQNGVGHYGVFSGSKFK 397 Rickettsia prow...
WP_024265522 319 VFQQYLLPKGELVHRGTRVKPEVITDIGLMTVEGENDDISGIGQTQAAHGLCANIPEDMKLDYVQPSVGHYGVFNGRRFR 398 Caulobacter vib...
WP_015472356 331 VFQEFLLPQGKWKVDGQLVKPSAIRKTALLSIEGELDDIAGLGQTEAVHDLCTGIDAAHRRHLVVEGAGHYGIFSGRRWR 410 Xanthomonas
CAC85536     395 NNIRPLVLNFIDAN 408 Rhodobacter capsulatus SB 1003
WP_003536442 394 REIAPRIVAFQRRH 407 Sinorhizobium meliloti
WP_004599520 398 QFIVPLIKEFIYDF 411 Rickettsia prowazekii
WP_024265522 399 EEIYPRVRKFIRKC 412 Caulobacter vibrioides
WP_015472356 411 EVVYPQVREFIARY 424 Xanthomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap