Conserved Protein Domain Family
PHA_reg_PhaR

?
TIGR01848: PHA_reg_PhaR 
polyhydroxyalkanoate synthesis repressor PhaR
Poly-B-hydroxyalkanoates are lipidlike carbon/energy storage polymers found in granular inclusions. PhaR is a regulatory protein found in general near other proteins associated with polyhydroxyalkanoate (PHA) granule biosynthesis and utilization. It is found to be a DNA-binding homotetramer that is also capable of binding short chain hydroxyalkanoic acids and PHA granules. PhaR may regulate the expression of itself, of the phasins that coat granules, and of enzymes that direct carbon flux into polymers stored in granules. The C-terminal region is poorly conserved in this family and is not part of this model.//GO terms added 12/6/04 [SS] [Fatty acid and phospholipid metabolism, Biosynthesis, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130907
View PSSM: TIGR01848
Aligned: 5 rows
Threshold Bit Score: 169.893
Threshold Setting Gi: 21113437
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45373         5 RIIKKYPNRRLYDTEVSRYITLADVRDLVMSGQPFRVLDSANDSDITRSILLQIMLEEET--GGQPLFSANMLAQIIRFY 82  Allochromatium ...
AAM41574      19 RIIKKYPNRRLYDTEISSYITIEDVRQLIIDGEEFEVRDAKSGEDLSRAVLLQIIADQEQ--DGEPMLSTQLLSQIIRFY 96  Xanthomonas cam...
CAC85533       8 LLIKRYASRRLYNTETSDYVTLEDIASFIRQGREVQIVDLKSGDDLTRQYLLQIIAEHES--RGENVLPVDVLTDLVRSY 85  Rhodobacter cap...
WP_011712833   5 RIIKKYPNRRLYDTETSEFVTLEGIHKLVVEGIEFKVIDSKSGADVTRTILLQVIADEEE--KGDPVFSTDFLTMIIRLY 82  Magnetococcus m...
WP_010918397  22 VIIKKYANRRLYNTASSSYVTLEHLSDMVKEGVDFVVYDAKTNDDITRSVLTQIIFEEENrgGGQNLLPIQFLRQLIGFY 101 Caulobacter vib...
P45373        83 GGTLQGTFARYLESSLDLFAKQQQEVTKA 111 Allochromatium vinosum DSM 180
AAM41574      97 GDSLQGFMGNYLERSMQVFLDQQQQFRQQ 125 Xanthomonas campestris pv. campestris str. ATCC 33913
CAC85533      86 TTQAQSVVPQFLAASFEMLREGQSKMMEN 114 Rhodobacter capsulatus SB 1003
WP_011712833  83 GGAMQSFTGDFLKQSITFYLDNQKSFLDQ 111 Magnetococcus marinus
WP_010918397 102 GNSMQAFLPSYLEMSLESFAKQQERLRGQ 130 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap