Conserved Protein Domain Family
type_I_hlyD

?
TIGR01843: type_I_hlyD 
type I secretion membrane fusion protein, HlyD family
Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 130902
View PSSM: TIGR01843
Aligned: 14 rows
Threshold Bit Score: 449.075
Threshold Setting Gi: 499271650
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P06739        54 SRRPRLVAYFIMGFLVIAFILSVLGQVEIVATANGKLTHSGRSKEIKPIENSIVKEIIVKEGESVRKGDVLLKLTALGAE 133 Escherichia coli
WP_011713618  48 SPFGRLITWTIMLFCALAVGWSIWGQIDVVAVAQGKILPNGHVKVIQPLEIGVVREIPVREGEQVAEGEVLVILDPTSTE 127 Magnetococcus m...
WP_011714541  25 GLAGWIYIPLFFGFVISLGVWAYFGVLDVVTFTTGEVVPSSQIKHVQHLEGGILRVIHVKEGEEVKLGQPLIELESIADE 104 Magnetococcus m...
WP_010918893  14 QAVARIGYGIIALTFVGLLGWAAFAPLDSAVIANGVVSAEGNRKTVQHLEGGMLAKILVREGEKVKAGQVLFELDPTQAN 93  Caulobacter vib...
WP_011712411  38 SRLLKIATVAVAGAILIFFIWANFANMEEVAHTTGEVATTDTIQFAQHLEGGIVGEIFIEEGQRVTQGQPLAQMKSEDVL 117 Magnetococcus m...
WP_011073845  26 KRIIKQITYFIAGSVFIMFVWSLFTNIEEIAKAKGQVIPLGHQQVIQSFSGGTLASILVSEGDLVKKGDVLANFIAIDSQ 105 Shewanella onei...
WP_010976110  17 SRHLIGVSVLALALVAGVGGWAATTELSSAIVAGGVVIVDDNVKKVQHLTGGIVGELLVKEGDRVEAGQVLIRLDGTTVR 96  Sinorhizobium m...
WP_011073978  25 PSGHRLIIWALAAMVACFLLWAGFAELDTVTTGSGKVIPSSQVQVIQSLDGGIMQELFVRDGDLVTKGQPLVRIDDTRFR 104 Shewanella onei...
WP_010970307  25 RLHTLLGLALIAISFGGFGYWAFAAPLAAAIIAQGSFVANGNNKIVQHLEGGIIEELLVAEGDKVKAGDILVKLDQTVAR 104 Sinorhizobium m...
CDI91816     291 KRFSRLGWGLVLLGFVGFLLWAGLAPLDKGVGVSGTVMVAGSRKAVQHPTGGLVRHIRVHEGERVEAGQVLLEMDATQAR 370 Pseudomonas aer...
P06739       134 ADTLKTQSSLLQARLEQTRYQILSRsIEL-----------------NKLPELKLPDEpY-FqnVSEEEVLRLTSLIKEQF 195 Escherichia coli
WP_011713618 128 ADLVRFEENLLSAQLDMARWQALAE-WDQ-----------------GEQPQILYRSP-D-G--APEGRVQKQRWLLKDTL 185 Magnetococcus m...
WP_011714541 105 SDLSELTARMVGLQLDIIRHDAAAKlAAH-----------------PDYPPELVS--------KYPQLVKQSRALFEARA 159 Magnetococcus m...
WP_010918893  94 AAAGITRNQYVALKAMEARLLAERDqRPS-----------------ISFPADLTSQRaD-P--MVARAIADEQAQFTERR 153 Caulobacter vib...
WP_011712411 118 AEYNQMHAREAILALQVAQKRALINsEP------------------IDLSGIER------P--LFDHMIAESVDFLDAQR 171 Magnetococcus m...
WP_011073845 106 AAAEELESKQANLVLKIERYSAFIEsREA-----------------N-FASYLES---------HPNLVKGHISDLERMN 158 Shewanella onei...
WP_010976110  97 ANLAIIESTLAQFYARRARLQAERMgAAS-----------------FEIEEDLAEFIpG-T--AAAKLIEGEQRLFASRR 156 Sinorhizobium m...
WP_011073978 105 SDFAQQEQEVFGLKTNAIRMRAELDsILIsdmtsdwreqvkitkkdLVFPDSIIQAE--------PALVKRQQEEYSGRL 176 Shewanella onei...
WP_010970307 105 ANARMLNLKRLRLEAVVGRLRAEAVgEDA-----------------FSVPQIVARQA-DdP--DVRAIMESQNVNFQSKK 164 Sinorhizobium m...
CDI91816     371 AQADGLFAQYLAALASLARLSAERDeKAR-----------------IEFPAELLALD-D-P--RLPTLLEQQRQLHDSRR 429 Pseudomonas aer...
P06739       196 STWQNQKYQKELNLDKKRAERLTVLARINRYENLSRVEKSRLDDFSSLLHKQAIAKHAVLEQENKYVEAVNELRVYKSQL 275 Escherichia coli
WP_011713618 186 LAHRASLQGIGHELKKQMAELASAKEAVRKYQQLLPLIAKRANAQKTLMEKKLAAQSHWLELEQERVELQRDLAIQKSRL 265 Magnetococcus m...
WP_011714541 160 STLHGEKVEMLNHYKENESLLGEIRARLRNSRERMKFLHEQVKISENLLKDELTSRLDHLALLRQERKLQSDIDEDEAGI 239 Magnetococcus m...
WP_010918893 154 QTIQGQVDLMNAQRLQYQSEIEGIDRQTQGLKDQLGFIEDELIDLRKLYDKGLVPRPRLLALEREQASLSGSIGRLTADR 233 Caulobacter vib...
WP_011712411 172 TSLASQREVILIQVKQKEMKLKKLLNQAQANRQQVQYYNEELEVRRPLTERKLMSRLQTLSAMQSREKTRADMLESEGDV 251 Magnetococcus m...
WP_011073845 159 NEKQAIIQSSLAEIAKSKAELASLDQEIPPLKHQITSAQQTINMMESIKESQAVSKLTMLESQQKLDSYIRELKSMEGKQ 238 Shewanella onei...
WP_010976110 157 SALSGMKGQLDSRKAQLADEVEGLTVQLNAIEEALKLIAEELTGVDSLFGQGLVPMQRVTTLKRQRAELEGGRGRHIAAR 236 Sinorhizobium m...
WP_011073978 177 DNLSNQLEILVRQIQQRQQEIDDLASKTTTLTTSMQLISRELELTRPLAKKGIVPEVELLKLERAVNDAQGELNSLRLLR 256 Shewanella onei...
WP_010970307 165 IKLRDQLNLIDQNIRSLEFRARGYALQQASFNRQLEILNEEREAKSKLADKGLIRRPELMALDRAIADAIGEIGRLESEV 244 Sinorhizobium m...
CDI91816     430 RALRLELDGLAETVAGSQAQLDGLQAALRSKEQQRAALEEQLRGLRQLASEGYVPRNRLLDSERLLAQVNGEIAGDLGSL 509 Pseudomonas aer...
P06739       276 EQIESEILSAKEEYQLVTQLFKNEILDKLRQTTDNIGLLTLELAKNEERQQASVIRAPVSVKVQQLKVHTEGGVVTTAET 355 Escherichia coli
WP_011713618 266 AELLAGLDVTRKRFAETEARFRKEVMEKYVESEQRVIDIEQELTKAARRNQLQVLRSPIDGVVQNLVIHTVGGVVQPAQE 345 Magnetococcus m...
WP_011714541 240 TGQQSKLRQIENGIQTLENRFVEQAKTEADKARQTLSELSHRLRKFDDRAARTILRAPANGVVKAILNNTVGGVVGAGET 319 Magnetococcus m...
WP_010918893 234 SKAVQGASDTQLKVRQIKQEFFEQVSQSITETRVRLAEVTEKEVVASDAQKRIKIVSPVNGTAQNLRFFTEGAVVRAAEP 313 Caulobacter vib...
WP_011712411 252 EVTKLELDEKWQNLRETEDSFYQDAMRELDGAYSELTQIRTTLPRLRDRMTRLVVRSPVDGVIKEIKVNGVGSVLGPGGE 331 Magnetococcus m...
WP_011073845 239 QVLARDIENLQRQLEQKQATLLKEVGEARTDAQAELLGITARLKSSDSQVQQNTITSPVDGIIQSIPNTSSGSVIQPGGT 318 Shewanella onei...
WP_010976110 237 AQARGKSSEIDLQILQLDEDRRSEISKELTDVEAKIAEYEERRTAATDQLRRLDITAPLSGRIYQLAIHTVNGVINPGET 316 Sinorhizobium m...
WP_011073978 257 PKLKAALDEAILKRREAVFVYAADLRAQLNETQTRLSRMNEAQVGAQDKVSKAIITSPVNGTIKTVHINTLGGVVQPGVD 336 Shewanella onei...
WP_010970307 245 KESYTQIDRYRQEAVIAVNTNKQAALDGLEAAEADLDGVREQVREASEVLGRATIRSPVDGTVVRSYFHTAGGVIASGKP 324 Sinorhizobium m...
CDI91816     510 GSTRRQILELRLRMAQRREKFQEEVRASLADAQVRAEELRNRLASARFDLANSEVRAPVAGLVVGQEVFTEGGVIAPGQQ 589 Pseudomonas aer...
P06739       356 LMVIVPEDDTLEVTALVQNKDIGFINVGQNAIIKVEAFPYTRYGYLVGKVKNINLDAIEDQRL-G---LVFNVIISIEEN 431 Escherichia coli
WP_011713618 346 LMRIVPTSGGIEVEAYLANKDIGFVEEGQAVEIKLETFPFTRYGLINGIVKKLSADAVEHEEM-G---LVYAARISMMKN 421 Magnetococcus m...
WP_011714541 320 VMDIVPMDDRLIVEGHLSPGDVGHVQIGQKGYITLASREGVRYGRLNAEVVHISPDTFTNERNqQ---TYYKVRMQTEGS 396 Magnetococcus m...
WP_010918893 314 LVDIAPEDEAFVIQAHFQPTDVDNVHMGMVTEVRLPAFHSREIPILNGTIQSLSQDRISDPQNkL---DYFLGIVRVDVK 390 Caulobacter vib...
WP_011712411 332 IAEIVPLEDTNKVEVKITTVDIGHVAVGQDVTVKVSTYDYARYGGIQGKLIAVSPSTFVDENGkD---PYYRGTIQLDQN 408 Magnetococcus m...
WP_011073845 319 VAVIVPTTPTALLEAKLSPRDIGFVSVGQKARIKIDAFDYSRYGALDGIVKRISPSTDADEKg-G---VFYKVQISIDKP 394 Shewanella onei...
WP_010976110 317 LMLVVPEAEDLTVEAKVATHDIDQIRVGQSVEIRFSAFNQRTTPEVEAEVVTVAPDLVTDERTgA---SYYPLRIRPKAE 393 Sinorhizobium m...
WP_011073978 337 IIEIVPSEDQLLIETKILPKDIAFLHTGLPAVVKVTAYDFTRYGGLKGTVEHISADTSQDEEg-N---SFYLIKVRTEES 412 Shewanella onei...
WP_010970307 325 IMEILPANVPLIIEAQLLRTAIDQLKVGEDATIRLSALNRRTTPVLKGKVFYVSADSIEEEVAgGqqrDVYIVRVEVPAS 404 Sinorhizobium m...
CDI91816     590 LMEILPERQPLLVDARLPVEMVDKVRVGLPVELMFSAFNQSTTPRVEGEVTLVSADRLLDERSeA---PYYRVRIRVGEE 666 Pseudomonas aer...
P06739       432 CLS-TGNKNIPLSSGMAVTAEIKTGMRSVISYLLSPLEESVTESLRER 478 Escherichia coli
WP_011713618 422 TMQ-VGERLVNITPGMSVTAEIKTGKRRIIEFFLSPIQKSMQEGLRER 468 Magnetococcus marinus
WP_011714541 397 TFV-QGKYRYELYPGVQVTAAIRTSERRVIDYFLEPLMLGQSRALRER 443 Magnetococcus marinus
WP_010918893 391 QLP--PHLRGRVTAGMPAQVIVPTGERTVLQYLFSPLRDTLRTTMREE 436 Caulobacter vibrioides
WP_011712411 409 YVG-SDPTKNLLLPGMTVEASIHTGSKTLMEYLLKPIYASVNDSFRER 455 Magnetococcus marinus
WP_011073845 395 YFG-DQPDKLELIPGMTGEADIVTGDKTVFQYLWKPVFTNVTEAFGER 441 Shewanella oneidensis
WP_010976110 394 SL--AKLKGLSLYPGMPAEVFIKIADRTVISYLTKPLTDQMRHAFRED 439 Sinorhizobium meliloti
WP_011073978 413 SLIkDDGTQMPIIPGMLTTVDVITGQRSILEYILNPILRAKDTALRER 460 Shewanella oneidensis
WP_010970307 405 EIG--RIHGFHPVPGMPAEVLITTSERTFFEYLTKPITDSMSRAFKET 450 Sinorhizobium meliloti
CDI91816     667 GV--RRLAGLEIRPGMPVEAFVRSGERSLLNYLFKPLADRTHLALGEE 712 Pseudomonas aeruginosa PA38182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap